KEGG   Francisella tularensis subsp. tularensis WY96-3418: FTW_1860
Entry
FTW_1860          CDS       T00495                                 

Gene name
efp
Definition
(GenBank) translation elongation factor P
  KO
K02356  elongation factor P
Organism
ftw  Francisella tularensis subsp. tularensis WY96-3418
Brite
KEGG Orthology (KO) [BR:ftw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ftw03012]
    FTW_1860 (efp)
Translation factors [BR:ftw03012]
 Prokaryotic type
  Elongation factors
   FTW_1860 (efp)
SSDB
Motif
Pfam: EFP_N Elong-fact-P_C EFP CRR7 Phage_hub_GP28
Other DBs
NCBI-ProteinID: ABO47520
UniProt: A4J019
Position
1745385..1745954
AA seq 189 aa
MASYSTNEFKGGLKVLIDGNPMVIVENEFVKPGKGQAFNRVKLKNLLNDRVVEKTFKSGE
SVEAADVEELTTVYSYFDGDSYVFMHPETFEQYMVSEEALGETKKWLKDQDEYQVILFNG
QPISIIAANFVNLEIIETDPGLKGDTAGTGGKPATLSTGAVVRVPLFVQTGEIIKVDTRT
STYVSRVKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggctagttatagtactaatgagtttaaaggcggcttaaaagttttaattgatggtaac
ccaatggttatcgttgagaatgagtttgtaaaaccaggtaaaggacaagcatttaataga
gttaagctaaaaaacttgcttaatgacagagtagttgaaaaaacttttaaatctggtgaa
tctgttgaagcagcagatgtagaagaactaacaactgtatattcatattttgatggtgat
agctatgtatttatgcaccctgaaacatttgagcaatatatggtttctgaagaagctctt
ggtgaaacaaaaaaatggcttaaagatcaggatgaatatcaagtaatcctttttaatggt
cagcctatttctattattgcggcgaactttgtaaaccttgaaattatcgaaacagatcct
ggtttaaaaggtgacaccgctggaacaggaggcaaacctgcaacactatcaactggtgca
gttgttagagttcctctttttgtacaaactggtgagattataaaagttgatacaagaaca
tcaacttatgtatctagagtcaaggactaa

DBGET integrated database retrieval system