KEGG   Francisella tularensis subsp. novicida U112: AW25_109Help
Entry
AW25_109          CDS       T03874                                 

Definition
(GenBank) phosphate transporter family protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
ftx  Francisella tularensis subsp. novicida U112
Brite
KEGG Orthology (KO) [BR:ftx00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    AW25_109
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AJI61525
UniProt: A0Q438
Position
complement(115628..116623)
Genome map
AA seq 331 aa AA seqDB search
MISSVLIAIIVIALFFEFTNGFHDAANVVATPIATKSLTPYQAIALAAFFNFLGAFFGTA
VAATISKGLVDTNVVTDIVLISALLGAISWNFFTWSFGIPSSSSHALIGSLVGAVIISSS
YQNVSYMTVVNKVLIPMVTSPVIAFFLALIICIVLLNIFMRFFRVRTTNKYIREMQVLST
SLLSFSHGSNDAQKTMSIITLALLSAGLVKTTQVPDWVIILCGVAMGLGTLSGGKKIIKT
LSAKLSKLEPVNAVSAELSSGILVLGASHIGLPVSTTQVASGSIMGAGYADAGVNWKVVK
KMAMAWILTIPACVFVTSAIYTVIYYIFGSF
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgatttcatcagtgcttatagccattattgtaatagcattgttttttgagtttacaaat
ggttttcatgatgcggcaaatgttgttgcaacacctattgcaactaaatcactaactcca
tatcaggcaatagctttagcagcattttttaactttttaggtgcattttttggtacagca
gttgctgcaacaatatcaaaaggacttgtagatactaatgtagttacagatattgttttg
atttctgcgttacttggagcgataagttggaacttttttacttggagctttgggattcct
tcaagctcatcacatgccttgataggttctttagttggcgcagtgattatcagctcaagc
tatcagaatgtaagctatatgacggtagttaataaagttttgattccaatggttacctca
cctgttattgcattctttttggcattgataatatgtatcgtgctgctaaatatttttatg
cgattttttagagttagaactacaaataaatacataagagaaatgcaggtattatctact
agtttactgtctttctctcatggatctaatgatgctcaaaaaacaatgtcaataataaca
ctagctttactaagtgcaggacttgttaagactactcaagtccctgattgggtgattata
ctttgtggagttgctatgggattagggactttatctggcggtaaaaagataattaaaaca
ctaagtgctaagctatcaaaactagaacctgtcaatgctgtttctgctgagttaagctca
gggatactagttttaggggcatcacatataggattaccagttagtacaactcaggttgca
tctggttctattatgggagctggatatgctgacgctggcgtaaattggaaagtcgtcaag
aaaatggcaatggcttggattctgactattccagcatgtgtattcgtcactagtgcaata
tataccgtaatttattatatctttggtagtttctaa

DBGET integrated database retrieval system