KEGG   Francisella tularensis subsp. novicida U112: AW25_1798Help
Entry
AW25_1798         CDS       T03874                                 

Gene name
rplV
Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
ftx  Francisella tularensis subsp. novicida U112
Pathway
ftx03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ftx00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    AW25_1798 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ftx03011]
    AW25_1798 (rplV)
Ribosome [BR:ftx03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    AW25_1798 (rplV)
  Bacteria
    AW25_1798 (rplV)
  Archaea
    AW25_1798 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AJI61374
UniProt: A0Q4I8
Position
complement(1868285..1868620)
Genome map
AA seq 111 aa AA seqDB search
MEVQAKLKFARISAQKCRLVADQIRGLPVEQAINLLTFSNKKAAVLIKGVLNSAVANAEH
NDGMDVDSLVVSTIFVDEGPTMKRFEARAKGRGNRILKRTSHITVKVAEKK
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggaagtacaagctaaattaaaatttgcaagaatctcagcgcagaagtgtagattagtt
gctgatcagatcaggggtctgccagtagagcaagctattaatcttttgacatttagtaat
aaaaaagctgctgtattaattaagggagttttgaactctgcagtagctaacgctgaacac
aatgatggtatggatgttgactctttagttgtgtcgactatctttgttgatgaaggtcct
acaatgaagcgttttgaagctagagcaaaaggtcgtggtaatcgtattctaaaaagaact
tcacatataactgtgaaagttgctgagaaaaaataa

DBGET integrated database retrieval system