KEGG   Francisella tularensis subsp. novicida U112: AW25_243
Entry
AW25_243          CDS       T03874                                 

Symbol
clpB
Name
(GenBank) ATP-dependent chaperone protein ClpB
  KO
K03695  ATP-dependent Clp protease ATP-binding subunit ClpB
Organism
ftx  Francisella tularensis subsp. novicida U112
Brite
KEGG Orthology (KO) [BR:ftx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ftx03110]
    AW25_243 (clpB)
Chaperones and folding catalysts [BR:ftx03110]
 Heat shock proteins
  HSP100
   AW25_243 (clpB)
SSDB
Motif
Pfam: AAA_2 AAA_lid_9 ClpB_D2-small AAA Clp_N AAA_5 AAA_16 AAA_22 Sigma54_activat TniB ATPase_2 IstB_IS21 AAA_14 bpMoxR AAA_7 AAA_24 DUF815 AAA_18 NACHT AAA_19 DUF5798 PduV-EutP DNA_pol3_delta2 T2SSE Torsin
Other DBs
NCBI-ProteinID: AJI61375
UniProt: A0Q8N0
Position
complement(257359..259938)
AA seq 859 aa
MNINKFTIKLQEALAEAQSYAFQQKATEFTSAHILKALLEQNDSVAISILSVCGVNIQNF
IKAVNDMVDSVAVLSGEGNPQVTPSRDLIATLHKMQELANKNGDEFISSEVFLLASLEDK
SLTGLYNKFGITKEKLTKAVNDYRGGEKVSSQNQEDMKGALDKYTVDLTDLARKGKIDPI
IGRDSEIRRTIQVLQRRTKNNPVLIGEPGVGKTAIVEGLAQRIVNDEVPEGVKGKKVLSL
DMGALLAGAKFRGDFEERLKSVLKELSKQEGNVILFIDELHTMVGAGKAEGSMDAGNMLK
PALARGELKCVGATTLDEYREYVEKDPALERRFQKVLVDEPTVEDTIAILRGLKERYELH
HGVNITDSAIVSAATLSHRYITDRQLPDKAIDLVDEAASQIRMEIDSKPEKMESLYRRII
QLKMQREQLKKEKDDATKKRLEILEQEIKGLDSEYKGLEELWKAEKLKMQGTSKLKEELE
KAKFELEKYQRVGDLSKMAELQYGKIPELEAQIKQIEETEAEPSENKLVRTSVTENEIAD
VVSKATGIPVSKMMEGEKDKLLNMESFLHKRVIGQDQAIKAVSNAVRRSRSGLSDPNRPI
GSFMFLGPTGVGKTELTKALAEFLFDDEDAMLRVDMSEFMEKHSVARLIGAPPGYVGYEQ
GGYLTEHVRRKPYSVILLDEVEKAHADVFNILLQVLDDGRLTDGQGRTVDFKNTVIVMTS
NLGSHRIQEMQGQDYDTVKDAVMEMVLSHFRPEFVNRVDDAIVFEPLNKEMITEIAKIQI
KRLEKRLADLSIGLEVTTEAMDKLADAGFDPVFGARPLKRAIQNNLENPLALKLLDGEFK
AEDKIVVDIDANNNITFSK
NT seq 2580 nt   +upstreamnt  +downstreamnt
atgaatataaataaatttacaataaaactacaagaagctctagctgaggctcaatcttat
gcttttcaacaaaaagcaactgagtttacatcagcacatatactaaaagctcttttggag
caaaatgatagtgttgctatatctatattaagcgtttgtggtgttaatatacaaaacttt
ataaaagctgtaaatgatatggttgatagtgttgcggtattatctggagaaggtaatcct
caagtaacaccatctagagatttaatagctacattacataaaatgcaagagcttgctaat
aaaaatggtgatgagtttatctcgagtgaggttttcttattagcctctttagaagacaaa
agtttaactgggctgtataacaaattcggtattacaaaagaaaaattaacaaaagcagtc
aatgattatcgcggaggggagaaagtgagtagtcaaaatcaagaagatatgaaaggtgca
ttagataaatacacggtagatctaactgatctagcgagaaaaggaaaaattgatccaata
atcggtagagatagtgagatccgtagaactattcaagtattacaaagaagaactaagaac
aaccctgtgcttataggtgagcctggtgttggtaaaactgctattgtcgagggcttagct
caacgaatagttaatgatgaagtaccagaaggtgtcaaaggtaaaaaagtactatcatta
gatatgggtgcactgctagctggtgctaaatttagaggagattttgaagagcgtctaaaa
tctgtattaaaagaattatcaaaacaagaaggtaatgtaattctctttatagatgaatta
catactatggtaggtgctggtaaagcagaaggatctatggatgctggtaatatgcttaaa
ccagctctagctagaggtgagctaaagtgtgttggtgcaacaactttagatgaatatcgt
gagtatgttgagaaagatccagctctagagagaagattccaaaaagtgctagttgatgaa
cctactgtagaagatactatcgctatacttagaggtctaaaagaaagatatgaactacat
catggtgtaaatatcacagattcagctattgtgagtgccgctacattatcacatagatat
atcacagatagacagctacctgataaagctatagatctagtagatgaagcagcaagccaa
attcgtatggaaatagactctaaacctgaaaaaatggaaagcttatatcgtagaatcatc
cagctgaaaatgcaacgcgaacagctaaagaaagagaaagatgatgctactaaaaaacgt
ttagagatacttgagcaagaaataaaagggctagactcagagtataaaggtctagaagag
ctttggaaagctgaaaagcttaagatgcaaggtacaagtaaactaaaagaagaacttgag
aaagctaagtttgaacttgaaaagtaccaaagagtgggtgatttgagcaaaatggcagaa
ttacaatacggtaaaatacctgagctagaagcacaaattaaacaaatagaagaaactgaa
gcagaaccttctgaaaacaaattagtgagaacatctgttacagaaaatgagattgctgat
gtagtttcaaaagctactggaatacctgtatctaagatgatggaaggcgaaaaagacaag
cttctaaatatggaaagtttcttacataaaagagtaattggacaagatcaagctataaaa
gcagtatcaaatgctgtaagaagatctcgttctggattatcagatccaaatagacctata
ggttcattcatgttcttaggtccaactggtgtcggtaaaactgagcttacaaaagcttta
gcagagtttttgtttgatgatgaagatgccatgcttagagtagatatgtctgagtttatg
gagaaacattctgtagctagactaataggcgcacctccgggatacgtaggttatgaacaa
ggcggctatctaactgagcatgttagaagaaaaccttattctgtaatcttgctagacgag
gttgaaaaagctcatgctgatgtatttaacatcttactacaagtgcttgacgatggtcgc
ttaacagatgggcaaggtagaacagtagactttaaaaatactgtaatagttatgacttct
aaccttggttcgcatagaatccaagaaatgcaaggtcaagactatgacacagtcaaagat
gctgtaatggaaatggtacttagccactttagacctgaatttgtaaatagagttgatgat
gcaattgtctttgaacctctaaacaaagagatgataactgaaatagctaaaatacaaatc
aaacgcttagaaaaacgtctagcagatctaagtataggattagaagtcacaactgaagct
atggataaactagctgatgctggctttgatcctgtgtttggtgctagaccgcttaagcgc
gctattcaaaacaacttagaaaaccctctggctctaaaacttctagatggtgagtttaaa
gctgaagataagatagttgtcgatattgacgctaataacaatattacattctctaaataa

DBGET integrated database retrieval system