KEGG   Francisella tularensis subsp. novicida DPG 3A-IS: CH70_1041Help
Entry
CH70_1041         CDS       T03875                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
fty  Francisella tularensis subsp. novicida DPG 3A-IS
Pathway
fty00010  Glycolysis / Gluconeogenesis
fty00053  Ascorbate and aldarate metabolism
fty00071  Fatty acid degradation
fty00280  Valine, leucine and isoleucine degradation
fty00310  Lysine degradation
fty00330  Arginine and proline metabolism
fty00340  Histidine metabolism
fty00380  Tryptophan metabolism
fty00410  beta-Alanine metabolism
fty00561  Glycerolipid metabolism
fty00620  Pyruvate metabolism
fty00625  Chloroalkane and chloroalkene degradation
fty01100  Metabolic pathways
fty01110  Biosynthesis of secondary metabolites
fty01120  Microbial metabolism in diverse environments
fty01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:fty00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CH70_1041
   00053 Ascorbate and aldarate metabolism
    CH70_1041
   00620 Pyruvate metabolism
    CH70_1041
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CH70_1041
   00561 Glycerolipid metabolism
    CH70_1041
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CH70_1041
   00310 Lysine degradation
    CH70_1041
   00330 Arginine and proline metabolism
    CH70_1041
   00340 Histidine metabolism
    CH70_1041
   00380 Tryptophan metabolism
    CH70_1041
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CH70_1041
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CH70_1041
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CH70_1041
Enzymes [BR:fty01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     CH70_1041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AJJ47530
UniProt: A0A0B6K790
Position
1053800..1055296
Genome map
AA seq 498 aa AA seqDB search
MSILKELDLGLQAYITNDTNNVIETLNPATGELLAKVRNQSVTTMQEAIAKATEVAKQWR
QVPAPKRGELVRLIGEELRRNKDHLGSLVSLEMGKSKQEGDGEVQEMIDMADFAVGQSRM
LYGMMMNSERHNHRMYEQWHPLGVVGVISAFNFPVAVWSWNAFIAVICGNTVVWKPSEKT
PLCSIAVHNICQKVIKEHNYPEIFYTVISKDVEVSKTLVNDERVNLVSFTGSTKVGQDVG
QQVAKRFGKSILELGGNNATIIDESANLKLAIPAAVFGAVGTAGQRCTSLRRLFIHESIY
DLVKEKMVNAYKQVKVGDPLDQANLMGPLIDQAAVDNFTRTVEQAINQGGKVLTGGKSIA
KPGFFVEPTIIEANHNMSIVAEENFCPILYIMPFKDIDEAIALNNSVIYGLSSSIFTDNL
QNAEKFLSSLGSDCGIANVNIGTSGAEIGGAFGGEKHTGGGREAGSDAWKAYMRRQTSTI
NYGKDLPLAQGIKFNLGE
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgagtattttaaaagagctagatttaggtttacaagcatatattactaacgatactaat
aacgttatagaaactctaaatcctgcaactggtgagctattagctaaagttagaaaccaa
agtgtaactactatgcaggaggctatagcaaaagctacagaagttgctaagcaatggcga
caagttccagcacctaaaagaggcgagttagttagacttatcggtgaggaattacgtaga
aacaaagatcatctgggtagtctagtatctcttgagatgggtaaatctaaacaagagggt
gatggtgaagtccaggaaatgatagatatggcagattttgctgtaggacaatcgcgtatg
ctttatggaatgatgatgaattctgagcgccataatcatagaatgtatgagcaatggcat
ccactaggtgttgttggagttatctcggcttttaactttcctgtagcagtgtggtcatgg
aatgcttttatagctgtaatttgtggtaatacagtagtctggaaaccatcagaaaaaaca
cctttgtgttctatcgcggtacataatatttgtcaaaaagtaattaaagagcataattac
cctgaaattttttacacagtcatttctaaagatgttgaggtttcaaaaacactagttaat
gatgaaagagtaaatctagtatctttcacaggttcaactaaggtagggcaagatgttggt
cagcaagttgctaaaaggtttggtaagtcaattttagaattaggtggtaataatgctaca
attattgatgagtccgctaatttgaaacttgcaattcctgcagcagtttttggtgcagtt
ggtacagctggtcaaagatgtacttcgctaagaagactctttatccatgaatcgatctat
gatttagtcaaagagaaaatggtcaatgcttacaagcaagtcaaagttggtgatcctctt
gatcaagctaatttaatgggacctcttatagatcaagctgcggttgataatttcactaga
actgtagagcaagctattaatcaaggtggtaaagttctaacaggtggtaaaagtatcgca
aagcctggcttttttgttgagccgacaattatcgaagctaatcataatatgtcaatcgtt
gctgaagagaatttttgtccaatattatacataatgccttttaaagatattgatgaagct
atagcactcaataacagtgtaatctacggtttatcaagctctatatttacggacaatctt
caaaatgctgaaaagttcttatctagcttaggtagtgattgtggtatagctaatgttaat
attggtacctctggagcagagattggaggagcttttggtggtgagaagcatactggagga
ggacgtgaagctggttcagatgcttggaaagcatatatgcgtcgtcagactagtactatt
aactatggtaaagatttaccattagcacaaggaattaaatttaatctaggggagtga

DBGET integrated database retrieval system