KEGG   Francisella tularensis subsp. novicida DPG 3A-IS: CH70_1842Help
Entry
CH70_1842         CDS       T03875                                 

Gene name
rplV
Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
fty  Francisella tularensis subsp. novicida DPG 3A-IS
Pathway
fty03010  Ribosome
Brite
KEGG Orthology (KO) [BR:fty00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CH70_1842 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:fty03011]
    CH70_1842 (rplV)
Ribosome [BR:fty03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CH70_1842 (rplV)
  Bacteria
    CH70_1842 (rplV)
  Archaea
    CH70_1842 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AJJ48260
UniProt: A0A1J0L0N5
Position
complement(1880557..1880892)
Genome map
AA seq 111 aa AA seqDB search
MEVQAKLKFARISAQKCRLVADQIRGLPVEQAINLLTFSNKKAAVLIKGVLNSAVANAEH
NDGMDVDSLVVSTIFVDEGPTMKRFEARAKGRGNRILKRTSHITVKVAEKK
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggaagtacaagctaaattaaaatttgcaagaatctcagcgcagaagtgtagattagtt
gctgatcagatcaggggtctgccagtagagcaagctattaatcttttgacatttagtaat
aagaaagctgctgtattaattaagggagttttgaactctgcagtagctaacgctgaacac
aatgatggtatggatgttgactctttagttgtgtcgactatcttcgttgatgaaggtcct
acaatgaagcgttttgaagctagagcaaaaggtcgtggtaatcgtattctaaaaagaact
tcacatataactgtgaaagttgctgagaaaaaataa

DBGET integrated database retrieval system