KEGG   Francisella tularensis subsp. novicida DPG 3A-IS: CH70_1860Help
Entry
CH70_1860         CDS       T03875                                 

Gene name
dfrA
Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
fty  Francisella tularensis subsp. novicida DPG 3A-IS
Pathway
fty00670  One carbon pool by folate
fty00790  Folate biosynthesis
fty01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fty00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CH70_1860 (dfrA)
   00670 One carbon pool by folate
    CH70_1860 (dfrA)
Enzymes [BR:fty01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     CH70_1860 (dfrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1 YoeB_toxin
Motif
Other DBs
NCBI-ProteinID: AJJ47616
UniProt: A0A1J0KPC8
Position
1893076..1893576
Genome map
AA seq 166 aa AA seqDB search
MISLIVAYDKNFGIGKENTLAWKLSEDLKNFKKITENNYIVMGRKTFESIGRPLPNRKNI
ILTRDKDYKQDKCLIINSTQDILNFAESKPHYEIFIIGGAQIYKEFLKYADRLYITEVDA
EMTDLDAFFPQWDKSKYKRIGHKQFKKDDKNEFNFTFSVFEKIKNL
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgatctcactaatcgttgcttatgataaaaactttggtataggtaaagaaaatactcta
gcatggaaactatcagaagatcttaagaactttaaaaaaataacagaaaacaactatatt
gttatgggtagaaaaacctttgaatcgattggtcgcccactaccgaatcgtaaaaatatt
attttaactagagacaaagattacaaacaagataaatgtttaataataaatagtactcag
gatattttaaattttgctgaatcaaaaccacactacgaaatatttataatcggtggtgca
cagatctataaagaatttctaaaatacgcagatagattgtatataactgaagttgatgca
gaaatgactgatcttgatgctttttttccacaatgggataaatcaaaatataaacgtatt
ggtcacaaacaattcaaaaaagatgataaaaatgaatttaattttacatttagtgtattt
gaaaaaattaaaaatttgtaa

DBGET integrated database retrieval system