KEGG   Francisella tularensis subsp. novicida DPG 3A-IS: CH70_780Help
Entry
CH70_780          CDS       T03875                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
fty  Francisella tularensis subsp. novicida DPG 3A-IS
Pathway
fty00520  Amino sugar and nucleotide sugar metabolism
fty01100  Metabolic pathways
fty01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:fty00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CH70_780 (nagA)
Enzymes [BR:fty01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     CH70_780 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: AJJ47069
UniProt: A0A0B6K922
Position
802276..803409
Genome map
AA seq 377 aa AA seqDB search
MQSYILKGGKIYSQNDFEAKDIVVKDNVISDIVDDAKPAAFNLPIIELSGDDYVIPGFID
IHIHGSKGADVMDGDVDALAVISKSLYTQGVTSYLATTMTAANEQILKAMRAIKDYNSQT
HLDSAKIVGVHLEGPFISPGKIGAQNPNYLQEADVTKMASWHNACDSLIKKITIAPEIKN
ANKVIEFCNSKNIISSIGHTSCTMAQALNAIEQGCTHATHLFNAMSPIEHRNPGAATALL
MSKKVLAELIVDGIHLHPDMVKFTYAIKGSDKIALITDAMSAQSAGEGVFELGGQKVIVK
DGQARLENGVLAGSVLTMNKALENVLKFTNCSLYDAVKMTSTNQAKSLGFKKGQIKVGFD
AEFVILDKNYQVKQVIG
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagctatattctaaaaggtggcaaaatttatagccaaaatgattttgaagctaag
gatattgtagttaaagataatgttattagtgatatagttgatgatgctaagccagcagct
tttaatttacctattattgagctaagtggtgatgattatgtgatacctggttttatcgat
atccatatccatggttcaaaaggcgctgatgttatggatggagatgttgatgccttagct
gtaatctctaaatcactatatacacaaggagtaactagctatcttgcgaccacaatgaca
gcagcaaatgagcaaatactcaaagcaatgcgtgctatcaaagattataattctcaaacc
cacttggatagtgcaaaaattgttggtgttcatctagaggggccatttatatcaccaggt
aagattggtgcacaaaatcccaattacctccaagaagcagatgttactaaaatggcaagt
tggcataatgcgtgtgatagtttaatcaaaaaaatcactattgccccagagattaagaat
gctaataaagtaatcgagttttgtaattctaaaaatataattagttcaataggtcatact
agctgtacaatggctcaagctctaaatgcgatagagcagggttgtacacatgcgacacat
ctatttaatgcaatgagtccgattgaacatcgcaatcctggtgcggcaacagcgttatta
atgtcaaaaaaagttttagcagagctaatagttgatggtattcatctacatcctgatatg
gttaagtttacctatgcgataaaaggtagtgataaaatcgcactaatcactgatgcgatg
tctgctcaaagtgctggtgaaggtgtatttgaattaggtggtcagaaagtcatagttaaa
gatggtcaggcaaggttagagaatggtgtgcttgcaggaagtgtcttgacaatgaataag
gcactagagaatgttttgaaatttacaaattgtagtctctatgatgctgtgaaaatgaca
agtacaaatcaagctaagtcattagggtttaaaaaaggccaaatcaaagtaggctttgat
gctgagtttgtaattctcgataaaaattatcaagttaaacaagttattggttag

DBGET integrated database retrieval system