KEGG   Francisella tularensis subsp. holarctica 425: CH68_1663Help
Entry
CH68_1663         CDS       T03715                                 

Gene name
kdsA
Definition
(GenBank) 3-deoxy-8-phosphooctulonate synthase
  KO
K01627  2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase) [EC:2.5.1.55]
Organism
ftz  Francisella tularensis subsp. holarctica 425
Pathway
ftz00540  Lipopolysaccharide biosynthesis
ftz01100  Metabolic pathways
Module
ftz_M00063  CMP-KDO biosynthesis
Brite
KEGG Orthology (KO) [BR:ftz00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    CH68_1663 (kdsA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:ftz01005]
    CH68_1663 (kdsA)
Enzymes [BR:ftz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.55  3-deoxy-8-phosphooctulonate synthase
     CH68_1663 (kdsA)
Lipopolysaccharide biosynthesis proteins [BR:ftz01005]
 Unusual sugar
  CH68_1663 (kdsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: AJI66248
UniProt: A0A0B3WL47
Position
complement(1451543..1452370)
Genome map
AA seq 275 aa AA seqDB search
MKIANFEVGNGKPFFLMSGPCVIESEQMAMDTAGYLAEVTKDLGINFVYKSSFDKANRSS
INSFRGLGVDKGLEILAKVKKTYNVPVVTDVHEDTPFAEVAEVVDVLQIPAFLCRQTNFI
LEVCKQGKPVNIKKGQFLAPWDMQHVVTKAKSTGNEQIMVCERGVSFGYNNLVSDMRSLE
IMKATGCPVVFDATHSVQLPGGQGSSSGGQREFVPVLSKAAMAVGIDGLFMETHPNPDEA
KSDGPNSFPMYKIKEFLSLLKELDHLVKSQPKTEL
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgctaattttgaagtaggaaatggtaagccatttttcttaatgtctggtcct
tgtgtcattgaatctgagcaaatggcgatggatactgctggatatcttgctgaggtaact
aaggatcttggaataaattttgtttataagtcatcttttgataaagcaaatcgctcatct
ataaatagctttagagggctaggtgtagataaaggtcttgaaattttggctaaggtcaaa
aagacttataatgtgcctgtcgttacagatgtccatgaagatacaccctttgctgaggtt
gctgaagttgttgatgtattacaaattcctgcttttttatgccgtcaaacaaactttatt
cttgaggtctgtaagcaaggaaaacctgtaaatatcaaaaagggtcagtttcttgcacct
tgggatatgcagcatgtagtaacaaaagctaaatctacaggcaatgagcagattatggtt
tgcgaaagaggtgtaagctttggttataataatctagtttcagatatgcgttcacttgag
attatgaaagctacaggatgtccggtagtatttgatgctactcattcagtgcaattacca
ggaggacaaggtagttcttctggtgggcagagagagtttgtaccagttttatcaaaagca
gctatggctgttggtatagatggactttttatggaaactcatccaaatcctgatgaggca
aaaagtgatggacctaattcgttcccaatgtataaaataaaagaatttttaagtttgcta
aaagagcttgatcatttagtaaaaagtcaaccaaagacagaactatag

DBGET integrated database retrieval system