KEGG   Fusobacterium ulcerans: C4N20_03180Help
Entry
C4N20_03180       CDS       T05433                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
ful  Fusobacterium ulcerans
Pathway
ful00260  Glycine, serine and threonine metabolism
ful01100  Metabolic pathways
ful01110  Biosynthesis of secondary metabolites
ful01120  Microbial metabolism in diverse environments
ful01130  Biosynthesis of antibiotics
ful01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ful00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    C4N20_03180
Enzymes [BR:ful01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     C4N20_03180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AVQ27134
UniProt: A0A2P1S153
Position
complement(693227..694270)
Genome map
AA seq 347 aa AA seqDB search
MISFKNDYSEGALPYIMEALLKTNMEQTVGYGEDEYTAQAVEAIKKSIKCDDCYVRLLVG
GTQTNLLTIAHSLRPHEAVIAADTGHISVHEGGAIEATGHKVIELKTSGDGKLNVEIVRK
SVDLHEDTHMVQPKMVYISNPTEIGTLYSKQELIDLYEYCKSRDLYLYIDGARLASALAS
EKNDLQLEDYPKYSDVFYIGGTKCGLLFGEALVIVNKELRKSQFIRITKQKGATLAKGRL
LGVQFAELFKGDNYYQVGKHSNEMAMTLKKAFLDKGFELKTDSYTNQQFPIFPVEMIEEI
GKKYRYEFWEKVDEKHSAIRFVTSWATKKEHVDEFLKDFEELCKKYK
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgataagttttaagaatgactacagtgaaggggcattgccatatataatggaagcttta
ttaaaaacaaatatggaacagacagttggatatggtgaagatgagtatacagctcaggct
gtagaagcaataaagaaaagcatcaaatgtgacgattgttatgtacgtcttttagtagga
gggactcaaacaaatctgcttacaatagctcattctttacgtcctcatgaggcggtaata
gctgctgatacaggacatataagtgtgcatgaaggtggagcaatagaagctactggtcat
aaagtaattgaattaaaaacttctggagacggaaaattaaatgtggagattgtaagaaaa
tcagtggatcttcatgaagatactcatatggttcaacctaaaatggtgtacatatcaaat
cctacagaaataggaactctttacagtaaacaggaacttattgatctttatgaatactgc
aaatctagggatctttatttatacattgatggagcgagattagcttcagctctggcttct
gaaaaaaatgatcttcagcttgaagactatccaaaatattcagatgttttctatattgga
ggaacaaaatgtggacttttatttggagaagctttggttatagtgaataaagaattgaga
aaaagtcagtttatacgtatcacaaaacaaaaaggggctactttagcaaaaggaagactt
ttaggagtacagtttgctgaattattcaaaggagataactactatcaagtaggaaaacac
tctaatgaaatggctatgacattaaaaaaagcatttttagataaagggtttgaattaaaa
acagattcatatacaaatcaacagtttccaatattcccagtagaaatgatagaggaaata
ggaaaaaaatacagatatgaattctgggaaaaagtagatgaaaaacattctgctatacgt
tttgtaacatcttgggcaactaagaaagaacatgtggatgaatttctaaaagattttgaa
gaattatgtaagaaatataaataa

DBGET integrated database retrieval system