KEGG   Fusobacterium nucleatum subsp. animalis 4_8: HMPREF0409_00700Help
Entry
HMPREF0409_00700  CDS       T02680                                 

Definition
(GenBank) cobyric acid synthase CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
fus  Fusobacterium nucleatum subsp. animalis 4_8
Pathway
fus00860  Porphyrin and chlorophyll metabolism
fus01100  Metabolic pathways
Module
fus_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:fus00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HMPREF0409_00700
Enzymes [BR:fus01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     HMPREF0409_00700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 AAA_26 CbiA GATase Peptidase_S51 MobB SNO
Motif
Other DBs
NCBI-ProteinID: AGM23482
UniProt: R9RCE5
Position
1055554..1057044
Genome map
AA seq 496 aa AA seqDB search
MKKANLMIVGTSSGAGKSLFVTALCRIFYKDKYKVSPFKSQNMALNSYITKDGKEMGRAQ
VVQAEASGLEPDVNMNPILLKPSTMNKIQIIVCGKSIGNMSGVEYNQYKKNLISVLKETY
SKIENENDIVVIEGAGSPAEINIKEEDISNFAMARIADAPVILVADIDRGGVFASIYGTI
MLLKEEDRKRIKGIVINKFRGNKEVLKSGFDIIENLTGVKTLGVIPYTDIDIEDEDSLSE
KYKSFKLNKNSNKIKISVIKLKHISNVTDIDALSIYDDVEIQFVTERSQIGNEDLIIIPG
SKNTIDDLKWLKESGIAEEIIKRTRTETIIFGICGGFQILGNKVKDPYHIEGDIEELNGL
GLLDLETIIENEKTLVQYKGKLSVNNGILKILNNFEIKGYEIHQGITQGNEKNLTTDDRT
IFVNRDNIIATYLHGIFDNKNFTDVLLNEIRRRKGLEEVNNNISYEEYKLKEFDKLEKLV
RENVDIDEIYKIIGLK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagctaatttaatgatagttggaacttcatcaggagcaggaaaaagtttattt
gttactgcactatgtagaattttttataaggataagtataaagtttctccttttaaatca
cagaatatggcacttaattcatatattacaaaagatggaaaagaaatgggaagagcacag
gttgttcaggcagaagcaagtggattagaacctgatgttaatatgaaccctatactttta
aaaccatcaactatgaataaaattcaaataatagtttgtgggaaatctatcggtaatatg
tcaggtgttgaatacaatcagtataaaaaaaatttaatttctgttttaaaagaaacttat
tctaaaatagaaaatgaaaatgatatagttgtaattgaaggagcaggaagtccagcagaa
ataaatataaaggaagaagatatttcaaattttgctatggcaagaattgcagatgcacct
gttattttagttgcagatatagatagaggaggagtttttgcttcaatctatggaacaatt
atgcttttaaaagaagaagacagaaaaagaattaaaggcatagttataaataaatttaga
ggtaataaagaagttttaaaatctggttttgacataatagaaaatttaacaggtgttaag
actttgggagttatcccttatacagatatagatattgaagatgaagatagtttaagtgaa
aaatataaaagttttaaattaaataaaaattcaaataaaataaaaatttcagtgataaaa
ttaaaacatatttcaaatgtgacagatattgacgccttatctatttatgatgatgttgaa
atacaatttgtaactgaaagaagccagataggaaatgaagatttaataataattccaggt
tctaaaaataccatagatgatttaaaatggcttaaagaaagtggaattgcagaagaaatt
ataaaaagaactaggacagaaaccatcatttttggtatttgtggaggctttcaaatttta
ggaaacaaggttaaagacccttatcatattgagggagatatagaagaattaaatggttta
gggcttttagatttagaaactattatagaaaatgaaaaaacacttgttcagtataaagga
aaattatctgtcaataatggtattttaaaaattttaaataactttgaaatcaaaggttat
gaaattcatcaggggattacacaaggaaatgagaaaaatttaactactgatgatagaact
atttttgtaaatagagataatattattgcaacttatttacatggaatttttgataataaa
aattttactgatgttcttttaaatgaaataaggagaagaaaaggtttagaagaagttaat
aataatatttcttatgaagaatataagttaaaagagtttgataaattagaaaaattagtt
agagaaaatgttgatatagatgaaatatataaaattataggtttaaaataa

DBGET integrated database retrieval system