KEGG   Fusobacterium nucleatum subsp. animalis 4_8: HMPREF0409_01501Help
Entry
HMPREF0409_01501  CDS       T02680                                 

Definition
(GenBank) CDP-diacylglycerol-glycerol-3-phosphate 3-phosphatidyltransferase
  KO
K00995  CDP-diacylglycerol---glycerol-3-phosphate 3-phosphatidyltransferase [EC:2.7.8.5]
Organism
fus  Fusobacterium nucleatum subsp. animalis 4_8
Pathway
fus00564  Glycerophospholipid metabolism
fus01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fus00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    HMPREF0409_01501
Enzymes [BR:fus01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.5  CDP-diacylglycerol---glycerol-3-phosphate 1-phosphatidyltransferase
     HMPREF0409_01501
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CDP-OH_P_transf
Motif
Other DBs
NCBI-ProteinID: AGM22692
UniProt: R9RA45
Position
complement(246512..247075)
Genome map
AA seq 187 aa AA seqDB search
MNLPNRLTMIRFILAVPFIIFLQYSDSSKYGLIFRLISLVIFVIASLTDFFDGYIARKYN
LITDFGKIMDPLADKILVISALVIFVQLEYIPGWMSIIVLAREFLISGIRILAAAKGEII
AAGNLGKYKTTSQMIVVIISLVIGPIGFHISDYYFTVAEVLMLIPVILTIWSGWEYTFKA
KHYFTEQ
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacctaatagacttactatgattagatttatattagcagtgccttttataata
tttttacaatattcagattcaagtaaatatggtttgatttttagattaatttctcttgtg
atatttgtaatagcatcactcacagatttttttgatggctatattgcaagaaaatacaat
ttaattactgattttgggaaaattatggatcctcttgccgataaaatacttgttatttca
gcacttgtaatatttgtacaattagagtatatccctggctggatgtctattattgtttta
gctcgtgaatttttgataagtggaataagaatacttgcagctgcaaaaggagaaattatt
gcagcaggtaatttaggaaaatataagacaacaagtcaaatgattgttgttataatctcc
ttagtaataggtcctattggttttcacatatctgattattattttacagtagcagaagta
ttgatgttaataccagttattttaacaatatggtcaggttgggaatatacttttaaagca
aaacactattttactgaacaatga

DBGET integrated database retrieval system