KEGG   Fusobacterium varium: FV113G1_02170Help
Entry
FV113G1_02170     CDS       T05280                                 

Gene name
nanA
Definition
(GenBank) N-acetylneuraminate lyase
  KO
K01639  N-acetylneuraminate lyase [EC:4.1.3.3]
Organism
fva  Fusobacterium varium
Pathway
fva00520  Amino sugar and nucleotide sugar metabolism
fva01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fva00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    FV113G1_02170 (nanA)
Enzymes [BR:fva01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.3  N-acetylneuraminate lyase
     FV113G1_02170 (nanA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHDPS
Motif
Other DBs
NCBI-ProteinID: BBA49870
UniProt: A0A250LPY9
Position
248148..249020
Genome map
AA seq 290 aa AA seqDB search
MKGIFSALMVPYNEDGSINEKGLREIVRHNIDNMKVDGLYVGGSTGENFMISTEEKKRVF
EIAIDEAKDQVQLIAQVGSINVFESVELGKYATKLGYKCLSAVTPFYYKFSFEEIKEYYF
TIVRETGNNMIIYSIPFLTGVNMSVAQFGELFANEKIIGVKFTAGDFFLLERMRKAYPNK
LILAGFDEMLLPAAVLGIDGAIGSTYNVNGLRAKEIFRLAKEGKIAEALEIQHVTNDLIE
GILANGLYGTIKEIMKLQGVDAGYCRRPMAKVTPEQVAGAKVLFDKYLAK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggaatattttcagctttaatggtaccatataatgaggatggatctataaatgaa
aaaggattaagagagatagtaagacataatattgataatatgaaagttgatggattatat
gtaggtggaagtactggagaaaattttatgatttctacagaagaaaagaaaagagtattt
gaaatagctatagatgaagctaaggatcaagtacagcttatagctcaagtagggagtatc
aatgtatttgaatcagtggaattaggtaaatatgcaactaaattagggtataaatgtctt
tctgctgtaacaccattttactataaatttagttttgaagaaattaaagaatactatttc
acaatagtaagagaaactggaaataatatgattatttattctattccatttttaactgga
gttaatatgtctgttgctcaatttggagagttatttgctaatgagaaaataattggagtt
aaatttacagctggagatttctttttattagaaagaatgagaaaagcttatccaaacaaa
ttaattcttgcaggatttgacgaaatgcttttaccagcagcagttcttggaattgatgga
gcaattggaagtacttataatgtaaatggattaagagcaaaagaaatattcagacttgca
aaagaagggaaaattgctgaagctttggaaatacagcatgtaacaaatgatcttattgaa
ggaattttggcaaatggattatatggaactatcaaggaaataatgaaacttcaaggagta
gatgcaggatattgcagaagacctatggcgaaagttactcctgaacaagtggctggagct
aaagttctttttgataaataccttgctaaataa

DBGET integrated database retrieval system