KEGG   Fusobacterium varium: FV113G1_06200Help
Entry
FV113G1_06200     CDS       T05280                                 

Definition
(GenBank) amino acid lyase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
fva  Fusobacterium varium
Pathway
fva00260  Glycine, serine and threonine metabolism
fva01100  Metabolic pathways
fva01110  Biosynthesis of secondary metabolites
fva01120  Microbial metabolism in diverse environments
fva01130  Biosynthesis of antibiotics
fva01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fva00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FV113G1_06200
Enzymes [BR:fva01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     FV113G1_06200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: BBA50273
UniProt: A0A250LRC5
Position
700028..701071
Genome map
AA seq 347 aa AA seqDB search
MISFKNDYSEGALPYVMEALLKTNMEQTVGYGEDEYTAQAVEAIKKSIKCEDCYVRLLVG
GTQTNLLTIAHSLRPHEAVIAADTGHISVHEGGAIEATGHKVIELKTSGDGKLNVELVRK
SVELHEDTHMVQPKMVYISNPTEIGTLYSKQELIDLFEYCKSKDLYLYIDGARLASALAS
EKNDLKLEDYPKYSDVFYIGGTKCGLLFGEALVIVNKELRKSQFIRITKQKGATLAKGRL
LGVQFAELFKGDNYYQVGKHSNEMAMTLKKAFLDKGFELKTDSYTNQQFPIFPVEMIEEI
GKKYRYEFWEKVNDKYSAIRFVTSWATKKEHVDEFLKDFEELCKKYK
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgataagttttaaaaatgattacagtgaaggggcattgccatatgtaatggaagcttta
ttaaaaacaaatatggaacagacagttggatatggtgaagatgagtatacagctcaggct
gtagaagcgataaaaaagagtataaaatgtgaggattgctatgtacgtcttttggtagga
ggaactcaaacaaatctgcttacaatagctcattctctccgtccgcatgaagcagtaata
gcagcagatacaggacatataagtgtacatgaaggtggagctatagaagctacaggacat
aaggtaattgaactaaagacttcaggagatggaaagctaaatgtagaattagtaagaaag
tctgtagaacttcatgaggatactcacatggtacagcctaaaatggtgtatatatcaaat
cctacagaaataggaactctttatagcaagcaagaacttattgatctttttgaatattgc
aaatctaaagatctttatttatatattgatggagcaaggcttgcatcagctttagcttca
gaaaaaaatgatttgaaacttgaagattatccaaaatattcagatgttttttatataggt
ggaacaaaatgtggacttctgtttggagaggctttagtaatagttaataaagaattaaga
aagagccaatttatacgtatcacaaagcaaaaaggggctactttggcaaaaggaagactt
ttaggggtacaatttgctgaattatttaagggcgacaattattatcaagtaggaaaacat
tctaatgaaatggctatgacattgaaaaaagcatttttagataagggatttgaattgaaa
acagattcatatacaaatcagcaatttccaatatttccagtagaaatgatagaggaaata
ggcaaaaaatatagatatgaattctgggaaaaagtaaatgataaatattctgctatacgt
tttgttacatcttgggcaactaaaaaagagcatgtagatgaatttttgaaagattttgaa
gaattgtgtaaaaaatataaataa

DBGET integrated database retrieval system