KEGG   Fusobacterium varium: FV113G1_33720Help
Entry
FV113G1_33720     CDS       T05280                                 

Definition
(GenBank) putative acetamidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
fva  Fusobacterium varium
Pathway
fva00330  Arginine and proline metabolism
fva00360  Phenylalanine metabolism
fva00380  Tryptophan metabolism
fva00627  Aminobenzoate degradation
fva00643  Styrene degradation
fva01100  Metabolic pathways
fva01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:fva00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    FV113G1_33720
   00360 Phenylalanine metabolism
    FV113G1_33720
   00380 Tryptophan metabolism
    FV113G1_33720
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    FV113G1_33720
   00643 Styrene degradation
    FV113G1_33720
Enzymes [BR:fva01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     FV113G1_33720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FmdA_AmdA
Motif
Other DBs
NCBI-ProteinID: BBA53020
UniProt: A0A250LYT9
Position
complement(3785465..3786367)
Genome map
AA seq 300 aa AA seqDB search
MIYISKDYVTDILKWDNKAAAHCKDGEIVVFETRDCYDNCITSSERPMGDRKDGLSNPVT
GALYVEGAEKGDILKVEIRDIKLRPWGVMRSSNTGGVFYKKYDKREAVIYSIRDNKILFD
DVLELEAEPMIGVIGTAPEGEEGILTITPGKHGGNMDCKKITAGSIIYLPVNVDGGLLSM
GDIHALMGDGEVFICGLETAGEITVKVSVLKNIKLPVPFLYSGKKIMTIQSAETLDKAGD
MAAKEMFEFVKDASGQNNLRTGMLMSLLSDMAVCQVVDPLLTMRVEFPLAVLEKYGYKLP
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgatatatataagtaaagattatgtaacagacatactcaaatgggataataaagcagca
gctcactgtaaagatggagagatagtagtatttgaaacgagagattgttatgataattgt
ataacaagctcagaaagacctatgggagataggaaagatggactttctaatccagtaaca
ggtgcattatatgtagagggagctgaaaaaggggatatattaaaagttgaaataagagat
ataaaacttcgcccttggggagtaatgcgttcttcaaatacaggtggagttttttataaa
aaatatgataaaagagaagctgtaatatattctattcgagataataagatactgtttgat
gatgtgctggaattagaggctgaacctatgataggagtaattggaactgctccagaagga
gaagagggaatactgacaattacaccaggaaaacatggcgggaatatggattgtaaaaaa
ataacagcagggtcaataatttatcttccagtaaatgtagatggcggacttctatcaatg
ggagatattcatgctcttatgggagatggagaagtatttatctgtggattggaaacagct
ggggagataactgtaaaagtaagtgtgctgaaaaatataaaactgccagtaccattttta
tattcaggaaaaaaaatcatgactatacaatctgctgaaactttagataaagcaggagat
atggcagcaaaagagatgtttgagtttgtaaaagatgcttctgggcagaataatttgaga
acaggaatgcttatgtcgttactttctgatatggcagtatgccaagtagtagatcctctt
cttacaatgagagtagaatttcctcttgcagtacttgaaaaatatggatataagcttcct
taa

DBGET integrated database retrieval system