KEGG   Fragaria vesca (woodland strawberry): 101295668Help
Entry
101295668         CDS       T02666                                 

Definition
(RefSeq) succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
fve00020  Citrate cycle (TCA cycle)
fve00640  Propanoate metabolism
fve01100  Metabolic pathways
fve01110  Biosynthesis of secondary metabolites
fve01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101295668
   00640 Propanoate metabolism
    101295668
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fve04147]
    101295668
Enzymes [BR:fve01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     101295668
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     101295668
Exosome [BR:fve04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101295668
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 Succ_CoA_lig
Motif
Other DBs
NCBI-GeneID: 101295668
NCBI-ProteinID: XP_004289972
Position
LG2
AA seq 422 aa AA seqDB search
MVRGLLKQLSSRSLSFAGKWQQQQLRRLNIHEYQGAELMSKYGVNVPKGVAVGSVDEVKK
VIESTFPNQSELVVKSQVLAGGRGLGTFKNGLKGGVHIVKADQVEDLAGKMLGQILVTKQ
TGAEGKIVSKVYLCEKLSLVNEMYFAITLDRKSAGPLIIACAKGGTSIEDLAEKFPDSIV
KVPIDVFKGITDEDAAKVVDGLSPKGADRNSSIEQVKKLYKLFSETDCTLLEINPLAETA
DNQLVAADAKLNFDDNAAFRQKEIFALRDPTQEDPREVAAAKADLNYIGLDGEIGCMVNG
AGLAMSTMDIIKLHGGTPANFLDVGGNASEGQVVEAFKILTSDDKVKAILVNIFGGIMKC
DVIASGIVNAAKQVQLKVPVVVRLEGTNVDQGKRILKESGMALITAEDLDDAAKKAVEAI
SK
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggtgagaggactactcaagcagctctcttctcgctctctctccttcgccggaaaatgg
cagcagcaacagctccgccgcctcaacatccacgaataccagggggcggagttgatgagc
aaatatggggtcaatgttcccaaaggtgtggccgtcggtagcgttgatgaggtcaagaag
gtgattgagagtactttccccaatcaaagtgagttggtggttaagagccaagttttggct
ggtggaagaggtttgggaacatttaaaaatggtctcaagggcggtgttcacattgtcaag
gctgaccaggttgaagacctcgctgggaagatgcttgggcagatacttgttacaaaacaa
acaggtgctgagggaaaaattgtcagcaaggtttatttgtgtgaaaaattgtcgcttgtc
aacgagatgtattttgctattactttggatcgcaaaagtgctggtcctcttataattgca
tgtgcaaagggaggaacgagcattgaggaccttgccgagaaattccctgattcaatagta
aaggtacctatcgatgttttcaaaggaattacagatgaagacgctgcaaaggttgttgat
ggtttgtctcccaaaggagctgatagaaatagttcaattgaacaagtgaagaaattatat
aagctattcagtgagactgactgcacactgttggaaatcaatccacttgcagagactgct
gataaccagctagtagctgctgatgcgaagttgaactttgatgacaatgccgcttttcgt
cagaaagaaattttcgctctccgtgatcctacacaggaagatccccgagaggtggctgct
gctaaagcagatttaaactatattggattagatggtgaaatcggttgcatggttaatggt
gctggtttagctatgtctactatggatattattaaactacatgggggaactcctgccaat
tttctagatgtaggtgggaatgcttctgaaggccaggttgtcgaggcatttaagattttg
acttcagatgacaaggttaaagccattttggtgaacatctttggtggaataatgaaatgt
gatgtgattgcaagtggaattgttaacgcagctaaacaggttcaactaaaagtaccagtg
gttgtccgtcttgagggtaccaatgttgaccaagggaagagaattttgaaggaaagtggg
atggcattaatcacagcagaagatctcgatgatgctgctaagaaagctgttgaagcaata
tctaagtga

DBGET integrated database retrieval system