KEGG   Fragaria vesca (woodland strawberry): 101297342Help
Entry
101297342         CDS       T02666                                 

Definition
(RefSeq) probable methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
fve00450  Selenocompound metabolism
fve00970  Aminoacyl-tRNA biosynthesis
fve01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fve00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    101297342
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    101297342
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:fve01007]
    101297342
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:fve03016]
    101297342
Enzymes [BR:fve01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     101297342
Amino acid related enzymes [BR:fve01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   101297342
Transfer RNA biogenesis [BR:fve03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    101297342
 Prokaryotic type
   Other AARSs
    101297342
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 Anticodon_1 tRNA-synt_1e Viral_protease
Motif
Other DBs
NCBI-GeneID: 101297342
NCBI-ProteinID: XP_004296962
Position
LG4
AA seq 794 aa AA seqDB search
MGDLAAAPKLPIPGQRNVLITSALPYVNNVPHLGNIIGCVLSADVFARYCRLRGYNTVYI
CGTDEYGTATETKALEEKCSPQEICDKYHAIHKQVYEWFNISFDKFGRTSTPEQTEVCQG
IFNRLLENNWLSENTMQQLYCDTCTRFLADRLVEGTCPTQGCDYASARGDQCENCGKLLN
PTELKDPKCKVCKSTPRIRDTNHLFLELPLLKDRLKEYIDKMSVEGSWSQNAIQATNAWL
KEGLRQRCITRDLKWGVPVPHDNFRDKVFYVWFDAPIGYVSITKCYTPDWEKWWKNPEDV
ELYQFMGKDNVPFHTVMFPSTLLGTGENWTLMKTISVTEYLNYEAGKFSKSKGIGVFGND
AKDTNIPVEVWRYYLLTNRPEVSDTLFTWADLQAKLNSELLNNLGNFINRVLSFVAKPSG
QGYDSIVPDAPDAVSDPLTEKIGEKVGKCVEEYVEAMEKVKLKQGLKLAMSISSEGNAYL
QESQFWKLYKQDRPRCSVVMRTAVGLVHLLACLLEPFMPSFSVEVFKQLNLPAETHISLC
DDKGDIDRARKPWEIVPIGHKIGKPEPLFKELNDDEVDFLRKKFAGSQADRKEREEAEAV
KLAEQLKKSKLSDKTGKKKQQATKSATEAEISISRLDIRVGLITKAQKHPDADSLYVEEI
DVGEGQPRTVVSGLVKFIPLEEMQNRKVCVLCNLKPATMRGIKSQAMVLAASNSDHTAVE
LVDPPLSAQVGERITFPGFEGEPDDVLNPKKKVWETLQVDLQSNNELVACYKDIPLATSA
GVCTVKSIRGGAIR
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atgggagacctcgctgccgctcccaagctccccatccccggccagcgcaacgtcctcatc
accagcgccttgccctacgtcaacaacgtccctcacctcggcaacatcatcggctgcgtc
ctcagcgccgacgtcttcgctcgctactgccgtctccgcggttacaacaccgtctacatc
tgcggcaccgatgagtacggcaccgccaccgagaccaaagccttggaggagaagtgtagc
ccgcaggagatctgcgacaaatatcatgcgattcataagcaggtgtatgaatggttcaat
ataagtttcgacaaattcggaagaacttcgacgccggagcagacggaggtttgccagggg
attttcaataggctgctggagaataactggctttcggagaacacaatgcagcagctgtac
tgtgatacatgtacacggtttttagccgacaggctcgtggaggggacgtgcccgactcag
ggttgtgattatgcttccgcaagaggagatcagtgtgagaactgtgggaagcttttgaac
cccacagaattgaaggatccaaagtgcaaggtttgtaagtcgactccacggattcgtgat
acaaaccatttgtttctggaacttcctttgctgaaggataggttgaaagaatatattgat
aaaatgtcagtggagggttcctggagccagaatgccattcaagcgacaaatgcatggctc
aaagaggggcttagacaacggtgtatcaccagagatctgaagtggggggttccagttcca
catgataacttcagggacaaggttttctatgtgtggtttgatgcgcctattggatatgtt
tcaattactaaatgctacactccggattgggagaaatggtggaagaatccagaggatgtg
gagttgtatcagtttatgggcaaagataatgtgccattccacacggtgatgtttccttcc
acgcttcttggaactggtgaaaattggactttgatgaagacaataagtgttactgaatac
ttgaactatgaagcaggaaaattttctaagagcaagggtatcggagtatttggaaacgat
gccaaagatacaaacattcctgttgaagtatggcgatattacttgctaaccaataggccc
gaggtgtcagacacattatttacatgggcggatctgcaagcgaaactcaacagtgaatta
ctgaataatttgggcaacttcattaaccgagttttgagttttgttgccaaaccttcaggt
caaggatatgactccattgttcctgatgctccagatgcagtctctgatcctttgacagag
aaaataggtgaaaaagtgggtaaatgtgtggaggaatacgtagaggccatggaaaaggta
aaactaaagcaaggactcaaactagccatgagcatttcgagcgaagggaatgcatatctg
caagaaagtcagttctggaaactttacaagcaagaccgacctcgctgctccgttgttatg
agaactgcagtggggctggtgcatcttcttgcctgcctattggagcctttcatgccatcg
ttttctgttgaggtatttaagcagcttaatttgcctgctgagacgcacatatcactttgt
gatgataaaggcgatattgatagggcaagaaagccttgggaaattgtaccaataggtcac
aagattgggaaaccagagccgttgttcaaggaattgaatgatgatgaagtagattttcta
aggaagaagtttgctggaagtcaggctgatagaaaggaaagggaagaagccgaagcagtg
aagttggctgagcaacttaagaaatcgaaactttcagacaagactggaaagaagaaacaa
caagcaacaaaatctgcaactgaagcagagatttccatatctagactagatattcgtgtc
ggccttattacaaaagctcagaaacatcctgatgctgattcactttatgtagaagagatt
gatgttggcgaaggacagcccagaacagttgtcagtggactagtcaagtttatacctctt
gaggaaatgcagaatcgaaaggtatgcgtcctttgcaacctgaagccagcgaccatgcgg
ggtattaaatcacaagcaatggttcttgctgcttcaaatagtgatcacaccgcagttgag
ttggttgatccaccactatctgctcaagttggggagagaattacattcccagggtttgaa
ggtgagcctgatgatgtgttgaaccccaagaagaaggtttgggagaccctgcaggtagat
ttgcagagtaacaatgagctagtcgcttgctataaagatattcccctcgctacatcagct
ggtgtttgcactgttaaatctattcgtggtggggcaattaggtag

DBGET integrated database retrieval system