KEGG   Fragaria vesca (woodland strawberry): 101301748Help
Entry
101301748         CDS       T02666                                 

Definition
(RefSeq) putative pre-mRNA-splicing factor ATP-dependent RNA helicase PRP1
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
fve03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:fve00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    101301748
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:fve03041]
    101301748
Enzymes [BR:fve01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     101301748
Spliceosome [BR:fve03041]
 Complex C
  Other components
   Step II factors
    101301748
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C DEAD AAA_22 AAA_19 AAA_30 ABC_tran DUF2075 AAA_33 T2SSE MMR_HSR1 Sigma54_activ_2 AAA_16 AAA_14 AAA_23 Helicase_RecD AAA_29 DAP3 FtsK_SpoIIIE ATPase_2
Motif
Other DBs
NCBI-GeneID: 101301748
NCBI-ProteinID: XP_004310054
Position
Un
AA seq 698 aa AA seqDB search
MAELPILQFEEKIIETVQNSPVVVIIGETGSGKSTQLSQMLHRRGYTNSGIVGVTQPRRV
AAVSVARRVSQELNVRLGDEVGYAIRFEDRTSDRTRIKYLTDGVLLRESLSNPELDQYSV
IILDEAHERSLNTDILLGLMKRLVKRRASNLKVIVTSATLDGDKVSQFFSNCPVLNVPGK
LYPVEILYSNERPKSYLEASLKTALDIHIKEPEGDVLIFMTGQDDIEKLVSKLEDRVRSL
EEGSVLDAIILPLHGSLQPEMQVRVFSPPPPNCRRFIVATNIAETSLTVDGVVYVIDSGY
VKQRQYNPSTGMYSLDVVQISKVQANQRAGRAGRTRPGKCYRLYPSIDYHEELLDATVPE
IQRSSLAGSVLYLKSLDLPDIDILKFDFLDSPSSESLQDALKQLYLIDAIDEDGLITRVG
KTMAELPLEPSLSRTLMEANDNGCLSQALTVAAMLSAETTLLPGRSKSTEKKRKHDHLDL
PDGSGWGDHIQLLQIYECWHQTHYNIDWCKDRGLQVRGMTFVKDVRKQLCQIMQKVAKGS
LDVQTSRRGKETQQDYNNLRKALCVGYANQLAERMVFHNGYRTLGFKPQVVQVHPSSVLK
PDDEGKFPNYVVYQELIATTRPYLRTVCAVNVSWVAPILNKVNNLNINKLSGGIDSIEEH
AEGNLASLPKKDVTAVPDDQESKIQAARERFLARKGKK
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atggcggagctcccaatcctccagttcgaagagaaaatcatcgaaacagtacaaaacagc
cccgtcgtggtcataatcggcgagaccggttccggtaagagcacgcagctctctcagatg
ctccaccgcagaggctacaccaactccggcatcgtcggcgtcactcagccccgccgtgtc
gccgccgtctccgtcgccagacgagtttcgcaggagctcaatgtccggctcggcgacgaa
gtcggatacgccatcagattcgaagatagaacttccgataggactcggatcaagtacttg
actgacggagttctcctccgtgaaagcttatccaacccggagctcgatcagtactctgtg
attatactcgacgaggctcacgagagaagtctcaacacggacatattgctgggactgatg
aagcggttggtgaagcgtcgcgcttcgaatttgaaggttattgttacttctgcaactctt
gatggtgataaagtgtcacagttcttttcgaattgccctgtgctgaatgtgcccgggaag
ctttaccctgtggagatattgtacagcaatgagcgtcctaagagctatcttgaggcttcg
ttaaagacagctctcgatatacatataaaggaacctgaaggtgatgtcttgatattcatg
actgggcaggatgacatagagaagttggtctctaagttagaagatagagttagaagcctg
gaggaaggatctgtcttggatgccataatccttcctcttcacggttctctgcagcctgaa
atgcaggtacgtgtatttagtcccccacctcctaattgtaggagatttattgttgccaca
aacattgctgaaacttctttgactgttgatggcgttgtgtatgttattgattctggttat
gttaagcaacggcagtacaacccctcaactggcatgtactccctcgatgttgttcaaatt
agcaaggtacaggccaatcaacgagcaggacgagctgggaggacacgtcctgggaaatgc
tatcgattatatccttccatcgattaccatgaggagctcctcgatgcaacagttcctgaa
attcaacgttcttcacttgctggaagtgttctttatttgaaatctttggacctccctgac
attgacattctcaaattcgattttcttgattctccttcctctgaatctttacaagatgct
ctgaagcagttgtatcttattgacgctattgatgaagatggattgatcacgagagttggg
aagacaatggctgaacttccactagaaccttcactgtcaagaaccttgatggaggcaaac
gataatggttgcttgtcccaggctttgactgttgctgctatgttatctgcagaaactaca
ttgcttcctggtcgaagcaagagtactgagaagaaaaggaaacatgatcatttggacctt
cctgatggttctggttggggtgatcatatccagttgctacagatctatgagtgctggcat
caaactcactataacattgattggtgcaaagaccgtggcttgcaggtaagagggatgaca
tttgtcaaggatgtaaggaaacagctgtgtcaaatcatgcaaaaagtggcaaagggatca
ttagatgtacagacaagcagaagagggaaagaaacccaacaggattataataacttgagg
aaggctttgtgtgtggggtatgcaaatcagcttgctgagagaatggtatttcacaatggc
tatcgaaccttaggttttaagccccaagtagtacaggtgcatccatcctctgtgctaaaa
ccagatgatgaagggaaatttccaaattatgtcgtgtaccaggaacttattgcgactact
cgtccatacttgcgcactgtatgtgctgtaaatgtttcatgggttgcacccattttgaac
aaggttaataacctaaacatcaacaagctgagcggtgggattgatagtatcgaagagcat
gcagagggaaatcttgctagtttgccaaagaaagatgttacagcagttcctgatgatcaa
gaaagtaaaatacaagcggctagagaacgatttcttgctcgtaaaggaaagaaatga

DBGET integrated database retrieval system