KEGG   Fragaria vesca (woodland strawberry): 101302205Help
Entry
101302205         CDS       T02666                                 

Definition
(RefSeq) phosphoinositide phospholipase C 2-like
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
fve00562  Inositol phosphate metabolism
fve01100  Metabolic pathways
fve04070  Phosphatidylinositol signaling system
fve04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:fve00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101302205
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    101302205
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    101302205
Enzymes [BR:fve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101302205
Membrane trafficking [BR:fve04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    101302205
 Endocytosis
  Macropinocytosis
   Phospholipase C
    101302205
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y C2 EF-hand_like DUF2264
Motif
Other DBs
NCBI-GeneID: 101302205
NCBI-ProteinID: XP_011469918
Position
LG7
AA seq 595 aa AA seqDB search
MSKQTYRVCFCFRRRFRLAVSEAPDDIKSLFDQYSENGLMSLDHLHRFLTEVQKEDLTKE
EAQTLLDQSLHEFRHLNIFHRKVLNLEAFFRFLFGDNNAPINTKVHHDMKAPLSHYYIHT
GHNSYLTGNQLSSDCSDVPIIEALHRGVRVIELDIWPNSTKDDVDVLHGGTLTAPVALLK
CFKSIKEHAFVASEYPVVITLEDHLTPNLQAKVAEMITQTFGEVLFSPPGSECLNEFPSP
ESLKRRVIISTKPPQEYLEAKAAAEKAAAAANDLKRGKSLAPDEEAWGREVPDQKGAVAE
DDKQNKLDEEDSPEEEYVEDVESKSPQNVAPEYKRLIAIHAGKPKGGLRECLKVDPNKVR
RLSLSEQQLEKASETHGKEIVRFTQRNILRVYPKGIRVDSSNYNPMIGWSHGAQMVAFNM
QGHGRSLWVMQGMFRANGGCGYVRKPDFLLNTTEIFDPKQKSSVKKTLKVKIYMGEGWYY
DFKHTHFDAYSPPDFYARVGIAGVAADTIMKKTKTLEDNWIPAWDEEFEFPLTCPELAVI
RIEVHEYDMSEKDDFGGQTSLPLSELKKGIRAVTLHDRKGEKYKSVKLLMHFDLV
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagcagacctacagagtgtgcttctgcttccgccgccgcttccgcctcgccgtg
tcggaagcgccggacgacatcaagtccctgttcgaccagtactccgagaatggcctcatg
agcctcgatcacctccaccgcttcctcaccgaagtccagaaggaggacctgaccaaggag
gaggcccagaccctactggatcagagcctccacgagttccgccacctcaatatcttccac
cgcaaggttctcaacctcgaggccttctttaggttcctcttcggcgacaacaacgcccct
atcaacaccaaggtacaccatgatatgaaagcgcctttgtcgcattattacatacacacc
ggacacaattcatacttgaccgggaatcagctgagcagcgactgcagtgatgtgccgatt
atagaagctcttcatagaggtgtgagggtgattgagcttgatatttggcctaattcgacc
aaagatgacgtggatgtgcttcatggagggaccttgactgctccagtggcacttctcaaa
tgcttcaaatctataaaggaacacgcttttgttgcatctgagtaccctgttgtaattacc
ttagaggatcatttaacccctaatcttcaagctaaagttgctgagatgatcactcaaaca
tttggagaggtgctgttttctcctccggggtccgagtgtcttaatgagtttccatcccca
gaatcactgaagagaagggttattatatcaactaaaccacctcaggaatatcttgaggct
aaagctgctgccgaaaaagctgctgcggctgcaaatgacttaaagaggggaaagagttta
gctcctgatgaggaagcttggggtagagaagtcccggaccaaaaaggagcagttgcagaa
gatgataagcagaataaattggatgaagaagatagccctgaggaggaatatgttgaggat
gtagagtccaagtcaccacaaaatgtagcacctgaatataagcggttaattgccattcat
gctgggaagcctaaaggtggattgagggagtgtctcaaagtggatcccaataaagtgcgg
cgtcttagcttaagtgagcaacaacttgaaaaggcatcagaaactcatggaaaagagata
gtcagatttacccagaggaatattctgagggtgtacccaaagggtatacgtgtggactca
tcgaattacaacccaatgattgggtggtcacatggtgctcagatggttgcattcaatatg
cagggacatggaagatcactgtgggtgatgcaaggaatgtttagagctaatggtggatgt
ggatatgtgagaaaaccagattttctgttgaacactacagagatctttgatcctaaacag
aagtcatcagttaagaaaacattgaaggtgaaaatctatatgggagaagggtggtattat
gattttaagcacacgcactttgatgcgtattcacctcctgatttttatgcaagggtaggt
attgctggagttgctgcagatactataatgaagaaaacaaagactctagaggacaactgg
attcctgcttgggatgaagaattcgaattccctttaacttgtcctgaactggctgtgatt
cgcattgaagttcacgagtacgacatgtcagaaaaggatgactttggagggcaaacaagc
ctcccactgtctgagctgaaaaagggcattcgagcagttaccttacatgatcgtaaggga
gagaagtacaaatccgtaaagcttcttatgcacttcgatttagtttga

DBGET integrated database retrieval system