KEGG   Fragaria vesca (woodland strawberry): 101302282Help
Entry
101302282         CDS       T02666                                 

Definition
(RefSeq) (-)-alpha-pinene synthase-like
  KO
K15803  (-)-germacrene D synthase [EC:4.2.3.75]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
fve00909  Sesquiterpenoid and triterpenoid biosynthesis
Brite
KEGG Orthology (KO) [BR:fve00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    101302282
Enzymes [BR:fve01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.75  (-)-germacrene D synthase
     101302282
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Terpene_synth_C Terpene_synth
Motif
Other DBs
NCBI-GeneID: 101302282
NCBI-ProteinID: XP_004303550
Position
LG6
AA seq 572 aa AA seqDB search
MSTQLASRFVIKRTSASLSIQTPKIVNPEILRRTAIYHPSIWGDRFSNYEESQDPMTRSL
LQKQVNQLKVVVKREVFRNASSDFSTQMKSIDAMQRLGIAYHFERDIENALEQAHAACVH
DGNLYNVALRFRLLREHGYNVSSDIFKRFKDANDNFKEGLTSDLPGMLSFYEATHLRIHG
EDILEDGLHFTTAHLESSANDVNHPLAAQITQALERPLRKFPERLYARHYISIFPDDPKS
LHHEAVALLLKLAKLDFNLVQSLHKKELSEIIRWWDELDFERELPFARNRIVELYFWTLG
VYAEPQYSKARHFLTKAIAFGSVLDDIYDAYGSFEELKIFTEAIQRWDVNCIDELPDYMK
IFYRRLFILCNEIEVEMVKQGKSYRVHFAKEIIKAQARLYFAEAQWLHENYTPSMDEYME
VSVRSVGNSFLSTMSLVGMGDIVTKDAFEWLANHPKILRASNIIFRLMDDLVSGKFEKER
EHIASSIDCYMKQYGVSEQETVDIFNKKVVDSWKDINEEFLRPTAVPVPVLTRVLNLTRV
VDLLYKKDDEYTRVGDVMKDGVASLLIHPVPS
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacccaattagcttctcgttttgtcatcaaaagaacatcagcttctctttcaatc
caaacaccaaaaattgttaaccctgaaatccttcggcgcactgcgatttatcaccctagc
atctggggagatcggttcagcaactatgaagaatcccaggaccctatgactcgatccctt
ctgcaaaagcaggttaatcaattgaaagtagtagtgaaaagggaagttttcagaaatgct
tcaagtgacttttcgactcagatgaagtcaatcgatgcgatgcagcgtctcggcattgca
taccatttcgaaagagacatagagaacgcactcgagcaggctcatgctgcatgtgttcat
gatggtaacttgtacaatgttgctcttcgttttcgattattgcgggaacatggatataat
gtttcatctgatatattcaagaggttcaaagatgcaaatgataacttcaaggaaggcttg
acttccgatctgcccggtatgctaagtttttatgaggcaacacatctaaggatccatggt
gaagatattctagaagatggtctacatttcactacagctcaccttgagtcatctgcaaac
gatgtaaatcatccactggcagcccagataactcaagccttagagagaccgctacgaaaa
tttccagagagattatacgcgaggcattacatatcaatcttcccggatgatccaaaatct
ttgcatcatgaagcagtagctttattattgaaacttgcaaagttagatttcaatcttgtt
cagtctttacacaagaaggagctcagtgagattattagatggtgggatgaactagatttt
gaaagggagctaccattcgcgagaaataggattgttgagctgtacttttggacattggga
gtatatgctgaaccccagtactcaaaggcaagacatttcttaacaaaagctattgcattt
ggatcagttttggatgacatctacgatgcatatggttcattcgaagaactcaaaatattt
actgaagcaattcaaaggtgggatgtcaattgtatagatgaactgccagactatatgaag
atcttctatcgtagactgttcattttgtgcaatgaaattgaggtggagatggtgaagcaa
ggaaaatcataccgagttcacttcgcaaaagaaattataaaagctcaagctcgactatac
tttgcggaggcacagtggcttcatgaaaactacactccaagtatggacgagtatatggag
gtctctgtacgttcggttggaaacagtttcctttcgacaatgtcgctagtcggaatggga
gacattgtaaccaaggatgcatttgagtggttggcaaatcaccctaaaattcttagagct
tccaatattatttttaggctcatggatgaccttgtttccggcaagtttgagaaagagaga
gagcatattgcttcaagtattgattgttacatgaagcaatatggggtatcggagcaagag
acggttgatatttttaacaaaaaagttgtagattcgtggaaggatataaacgaagagttt
ttgagaccgactgctgttcctgtgccagtgcttactcgtgttcttaacctaaccagagtt
gttgatcttctttacaaaaaggatgatgagtacacacgagtgggagatgtgatgaaagat
ggtgttgcctccctcctaattcatccggtaccatcgtga

DBGET integrated database retrieval system