KEGG   Fragaria vesca (woodland strawberry): 101304033Help
Entry
101304033         CDS       T02666                                 

Definition
(RefSeq) glucomannan 4-beta-mannosyltransferase 9-like
  KO
K13680  beta-mannan synthase [EC:2.4.1.32]
Organism
fve  Fragaria vesca (woodland strawberry)
Brite
KEGG Orthology (KO) [BR:fve00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:fve01003]
    101304033
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:fve02000]
    101304033
Enzymes [BR:fve01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.32  glucomannan 4-beta-mannosyltransferase
     101304033
Glycosyltransferases [BR:fve01003]
 Polysaccharide
  Structural polysaccharide
   101304033
Transporters [BR:fve02000]
 Other Transporters
  Others
   101304033
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_tranf_2_3 Glyco_trans_2_3 Glycos_transf_2 Glyco_transf_21
Motif
Other DBs
NCBI-GeneID: 101304033
NCBI-ProteinID: XP_004307031
Position
LG7
AA seq 518 aa AA seqDB search
MEAFQGAGQIGLVLQQAKAPLIVPLLRFLVAVCLGMSVLLFVEKVYMGIVIMLVKVFRRR
PEKRWKWEAIKDDVELGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIIVQVLD
DSTDPLIKDLVEVEVQRWASKGINIKYEIRDNRHGYKAGALKEGMKHSYVKQCDYVAIFD
ADFQPEPDFLWRTIPFLLHNPDIALVQTRWKFVNADECLMTRMQEMSLDYHFTVEQEVGS
ATHAFFGFNGTAGVWRITALNEAGGWKDRTTVEDMDLAVRASLRGWKFVYISDIKVKNEL
PSTFKAYRYQQHRWSCGPANLFRKMIMEILRNKKVSPLKKFHVIYSFFFVRKIVAHIVTF
VFYCVILPATVLVPEVQVPIWGAVYIPSTITLLNAVGTPRSLHLLIFWILFENVMSLHRT
KATFIGLFEAGRVDEWVVTEKLGDALKTKSAVKAHRKPRVRIGERLHLLELIVGLYLFFC
GCYDLAYGKNRFFIYLFLQSIAFFIAGVGYVGTFVPSS
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgttccaaggagctggccaaatcgggctggtattgcagcaggcgaaagcgccg
ctgatcgtgccgctgttgcgatttttggtggcggtgtgcttggggatgtctgtgttgctc
ttcgtggagaaggtgtacatgggcattgtcataatgttggtcaaggttttcagaagaaga
cctgagaagcgttggaaatgggaggcaattaaggatgatgtggagcttggcaactctgct
taccccatggttcttgtgcaaattccaatgtacaatgaaaaagaggtttatcagctttct
attggagctgcatgtgggctttcatggccttctgataggatcatagttcaagttcttgat
gattcaactgacccactcattaaggatttggtggaagtagaagtgcagagatgggcaagc
aaaggaataaacataaagtacgagatcagagacaacagacatgggtacaaagcaggggct
ctcaaagagggaatgaagcactcttacgtcaaacagtgtgactacgtcgccatctttgat
gccgacttccaacctgagcccgattttctctggcgtacaatcccgtttctccttcacaac
cctgacattgctcttgtccaaactcgttggaaatttgtaaatgctgatgagtgcttaatg
accagaatgcaagagatgtctctagattaccatttcacagtggagcaagaagttgggtct
gcaactcatgccttctttggttttaacggcacagctggagtgtggagaatcacagcccta
aatgaggctggaggctggaaggaccgcacaactgtggaggatatggatttagctgtccga
gctagtcttagaggctggaagttcgtctatatttctgacatcaaggtgaaaaatgaattg
cccagtactttcaaagcctatcgttatcagcagcaccgatggtcttgtggcccagctaat
ctcttccggaagatgataatggagattttaagaaacaagaaggtgtccccattgaagaag
tttcatgtgatctacagctttttctttgttcgcaaaattgtagcacatattgtcactttt
gtcttctactgtgttattttgccagcaacggttttggttcctgaagttcaagttcccata
tggggtgctgtttatattccttctactattactctcctcaatgcagttggaactcctaga
tcactccacctattgattttctggattctttttgagaatgtaatgtccctgcatcggact
aaagcaacatttataggcctgtttgaagcagggagagtagatgaatgggtcgtcacggag
aaattgggagatgctctcaagacaaaatcagctgtaaaagctcacaggaagcctcgagtg
aggatcggagaaagactccatttgcttgagctcattgttggactctacctcttcttctgt
gggtgctatgatcttgcttatggaaagaaccgcttcttcatctaccttttcctccaatcc
attgcattcttcattgccggggttggttatgttggcactttcgttcctagctcttaa

DBGET integrated database retrieval system