KEGG   Fragaria vesca (woodland strawberry): 101304435Help
Entry
101304435         CDS       T02666                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP15-1
  KO
K09569  FK506-binding protein 2 [EC:5.2.1.8]
Organism
fve  Fragaria vesca (woodland strawberry)
Brite
KEGG Orthology (KO) [BR:fve00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:fve03110]
    101304435
Enzymes [BR:fve01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     101304435
Chaperones and folding catalysts [BR:fve03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    101304435
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C
Motif
Other DBs
NCBI-GeneID: 101304435
NCBI-ProteinID: XP_004290161
Position
LG2
AA seq 146 aa AA seqDB search
MRMKAATIILILPLLSFLAFAGKVADVKTLQIGVKYKPKTCELKARKGDKVRVHYRGKLT
DGTVFDSSFERGDPIAFELGVGQVIKGWDQGISGMCVGEKRKLKIPAHMGYGDQGSPPTI
PGGATLIFDTELVEILGRDSDKDAEL
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgaggatgaaggctgctaccattatcttgattctgcctcttctttcgttcttggctttt
gcggggaaggtcgccgatgtcaaaaccttgcagattggtgtcaagtataagccaaagact
tgtgaacttaaggctcgcaaaggtgataaagtcagggtacactaccggggaaaactcact
gatggaaccgtctttgattctagttttgaaaggggtgatccaattgcttttgagcttgga
gttggtcaagttataaaaggatgggaccaaggaatttcgggaatgtgcgttggcgagaag
cggaagttgaaaatacctgcacatatgggctatggggatcagggttctccaccaactatt
ccaggtggtgccacactgatcttcgacactgaactcgttgagattttggggagagattca
gacaaagatgcggagctgtag

DBGET integrated database retrieval system