KEGG   Fragaria vesca (woodland strawberry): 101304831Help
Entry
101304831         CDS       T02666                                 

Definition
(RefSeq) glutamate--glyoxylate aminotransferase 2
  KO
K14272  glutamate--glyoxylate aminotransferase [EC:2.6.1.4 2.6.1.2 2.6.1.44]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
fve00220  Arginine biosynthesis
fve00250  Alanine, aspartate and glutamate metabolism
fve00260  Glycine, serine and threonine metabolism
fve00630  Glyoxylate and dicarboxylate metabolism
fve00710  Carbon fixation in photosynthetic organisms
fve01100  Metabolic pathways
fve01110  Biosynthesis of secondary metabolites
fve01200  Carbon metabolism
fve01210  2-Oxocarboxylic acid metabolism
fve01230  Biosynthesis of amino acids
Module
fve_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
fve_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:fve00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    101304831
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    101304831
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101304831
   00260 Glycine, serine and threonine metabolism
    101304831
   00220 Arginine biosynthesis
    101304831
Enzymes [BR:fve01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     101304831
    2.6.1.4  glycine transaminase
     101304831
    2.6.1.44  alanine---glyoxylate transaminase
     101304831
Amino acid related enzymes [BR:fve01007]
 Aminotransferase (transaminase)
  Class I
   101304831
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 101304831
NCBI-ProteinID: XP_004309987
Position
Un
AA seq 481 aa AA seqDB search
MPPKALDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
QVVALCQAPFLLDDPNVGLLFPADAISRAKHYLSVTSGGLGAYSDSRGIPAIRKEVAEFI
EKRDGYPSDPELIYLTDGASKGVMQILNAIIRGAGDGVLVPVPQYPLYSAAISLFGGSLV
PYYLEETANWGLDVTDLRQSVITARSKGITVRAMVIINPGNPTGQCLSEANLREIINFCI
QENLVLLGDEVYQQNVYQDERPFISARKVLMGMGPFISKELQLVSFHSVSKGYWGECGQR
GGYFEMTNIPPQTVDEIYKVASVALSPNVPAQIFMGLMVNPPKPGDISYDQFARESKEIL
ESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIQAAKSAGKVPDVFYCLKL
LEATGISTVPGSGFGQKDGVFHLRTTILPAEEDMPAIMDSFKKFNNEFMEQYEDDRGYSR
M
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgccaccaaaggcattggattatgaatcactgaatgagaatgtgaagaaggttcagtat
gctgttagaggcgagctatatcttcgagcttctgagcttcagaaggaaggaaagaagatc
attttcacaaatgttggaaatcctcatgctctcggacagaagcccctaactttccctcgc
caggtggttgctctatgtcaagctccatttttattagatgaccccaatgtaggactgctc
ttccctgctgatgcaatttcaagggctaaacattacctctcagttacttctggtggtcta
ggtgcttacagtgattctcgaggtattcctgcaattaggaaggaagtggcagagttcatt
gaaaaacgtgatggttatccaagtgacccagaactcatatatctcactgatggtgccagt
aaaggtgtaatgcagatcttaaatgccataatccgtggtgcaggggatggggttttggtt
ccagttccacaataccctctttactcagctgcaatatctctatttggtggttctcttgtt
ccgtattacctggaagaaactgcgaactggggtcttgatgttactgatcttcgccagtca
gtcataacagctcgctccaaaggaattactgtgagagcaatggtgattataaaccctggt
aaccctactggtcagtgtcttagtgaagctaatttaagagagataataaacttctgtatc
caagaaaacctggtcttgcttggtgatgaagtttatcagcagaatgtataccaggatgag
cgcccctttattagtgctagaaaggtgttgatgggtatggggccattcataagcaaggag
ctccagcttgtttctttccactctgtgtcaaaaggatattggggtgaatgtggacagcgt
ggtggatactttgagatgacaaacattcctccacagacagttgatgagatatataaggtt
gcatcagtggcactcagtccaaatgttcctgcacaaatatttatgggccttatggtcaac
cctcccaaacctggagatatttcatatgaccagtttgctagggaaagcaaagagatcctt
gaatctctgaggagaagagcacgtttaatgactgatggattcaacagctgcagaaacgta
gtttgtaatttcactgaaggtgccatgtattccttccctcaaatacgcttgccaccaaga
gcaattcaggctgctaaaagcgctggaaaagttcctgatgtattctactgtctcaagctt
ttggaagccaccggcatttccactgttcctggttcagggtttggacagaaagatggggtc
ttccacttgaggacaaccatcttaccagctgaggaagacatgcctgctatcatggacagt
ttcaagaagttcaacaatgagttcatggagcaatatgaagatgacagaggttattcaagg
atgtga

DBGET integrated database retrieval system