KEGG   Fragaria vesca (woodland strawberry): 101305524Help
Entry
101305524         CDS       T02666                                 

Definition
(RefSeq) protein IWS1 homolog
  KO
K17498  transcription factor SPN1
Organism
fve  Fragaria vesca (woodland strawberry)
Brite
KEGG Orthology (KO) [BR:fve00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:fve03021]
    101305524
Transcription machinery [BR:fve03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     101305524
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Med26 Mfa_like_1
Motif
Other DBs
NCBI-GeneID: 101305524
NCBI-ProteinID: XP_011470316
Position
LG7
AA seq 395 aa AA seqDB search
MAYEDDHELMPGSYEKEEQRRVKRMKKEKMGSSLTGQSSSVKAEVMEMWETVGAGDSNLD
DANLVIVDTGVLPHAEEAVENEIDALFKVGKKKKKNERSPAEIAMEVEHIMAELEVTAEE
DAELNRQGKPAINKLKKMSLLTEVLSKKQLQQEFLDHGVLTLLKNWLAPLPDGSLPNIDI
REAILKILMDYPLDLEQHDRRDQLKQSGLGKAIMFLSKFDEETTCNRKLARELVDKWSRP
LFNKSIRFEDMRNVEEEKRVPLRRPSVSSSSSGMDQLRDGDLDLNDEFSRKRKSTSSSRQ
VIRPEASQMDFTVRPEPKIDPYEIRALNKEAKHDQRQMRMNKKLRQLKHKTRAGKRLQAT
KLSVESCNSFFDEERNTLGYPMKVVIVRSCVDKYF
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcttacgaagacgatcatgagttgatgccggggagttatgagaaggaggaacagcgc
agggttaagagaatgaagaaggagaaaatggggtcgagtctcaccgggcagtcgtcttct
gttaaggccgaggtcatggagatgtgggaaactgttggcgccggcgactcgaatctcgac
gatgccaacttagtaatagtcgacactggcgtgcttccgcacgctgaagaggctgtggaa
aatgaaatcgatgcgctctttaaggtgggtaagaaaaagaagaagaacgaaagaagtcca
gcggaaatagcaatggaggtggagcatatcatggcggaactggaggttacagctgaagag
gatgcagagcttaacagacaagggaaacctgccattaataaactgaagaagatgtcacta
ctcacagaggtcctctcaaagaagcagcttcaacaagagttcttggatcatggagtgttg
actctgctcaagaattggcttgcacctcttccagatggaagtttaccaaacatagacatt
cgagaagcgattttgaagattctgatggattaccctcttgatctagagcagcatgataga
agagaccaactgaagcaaagtgggcttggaaaggccattatgtttctctcaaaatttgat
gaagaaacaacttgtaacagaaaacttgctagggaattggttgacaaatggagtcgacct
ttgttcaataaaagcataaggtttgaggacatgagaaatgttgaggaggagaagagggtt
cccttgagaaggccatcagtgagcagcagtagttcgggaatggatcagcttagagatggt
gatcttgacttgaatgatgagttttcaaggaaaagaaaatccacatcatcttctcggcaa
gttattaggccagaagcgtcacaaatggattttacagtgcgcccagaacctaagatcgat
ccttatgaaattagagctctcaataaagaagcaaaacatgatcagaggcagatgaggatg
aacaagaagttgcgacagttgaagcacaaaacaagagcaggcaagcgtcttcaagccaca
aagctaagtgtggaaagttgtaatagtttttttgatgaagaaagaaatacattagggtat
ccaatgaaagttgtaattgttcgttcatgtgttgataaatatttttga

DBGET integrated database retrieval system