KEGG   Fragaria vesca (woodland strawberry): 101305546Help
Entry
101305546         CDS       T02666                                 

Definition
(RefSeq) tyrosine decarboxylase 1-like
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
fve00350  Tyrosine metabolism
fve00360  Phenylalanine metabolism
fve00380  Tryptophan metabolism
fve00950  Isoquinoline alkaloid biosynthesis
fve00965  Betalain biosynthesis
fve01100  Metabolic pathways
fve01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fve00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    101305546
   00360 Phenylalanine metabolism
    101305546
   00380 Tryptophan metabolism
    101305546
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    101305546
   00950 Isoquinoline alkaloid biosynthesis
    101305546
   00965 Betalain biosynthesis
    101305546
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fve04147]
    101305546
Enzymes [BR:fve01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     101305546
    4.1.1.105  L-tryptophan decarboxylase
     101305546
Exosome [BR:fve04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101305546
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC DegT_DnrJ_EryC1 DUF1148 LysE Aminotran_5 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 101305546
NCBI-ProteinID: XP_011460681
Position
LG3
AA seq 524 aa AA seqDB search
MGSLPFLHDPIENSSSHLTKPLDSEEFRKQGYMVIDFIADYYQNIENYPVLSRVESGYLK
KCLPDSAPYNPDSIQTILQDVKDHIIPGLTHWQSPNFFAYFSSTASTAGFLGEMLTTGFN
VVGFNWVSSPAATELEHLVMEWLADMLQLPKSFHFSGNGGGVLHGSTCEAIVCTMVAARD
QMLSQIGSDNLGKLVVYGSDQTHSTLQKATQIVGIKPENFRVIKTTKSAEFALSPEMLRL
TVCSDLDKGLLPLFLCATIGTTSTTAIDPLEALCDVAKEHGIWVHVDAAYAGSACICPEF
RHFIDGVEGANSFSFNPHKWLFTAMDCCCLWVKNPSALIRSLSTNPEYLRNKASDSKQVV
DYKDWQIALSRRFRALKMWLLLRSYGVANLRSFIRSHVKMAKIFEVLVRMDNRFEIVVPR
NFSLVCFRISPSAIVSDDHSYNGEEYNMVNEINCKLLEAINASGSVFMTHAVVGGVYLLR
CAVGATLTEEKHIVEAWKVVQGQAHAILSACIVDLHNPMRYPNI
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgggtagccttccattcctccatgatccaatagaaaacagctcatcccacctgaccaaa
cctctagactctgaagagttcaggaaacaagggtatatggtcatagacttcattgcagat
tactaccaaaacatagagaactacccagttttaagccgagtagaatccggatatttgaaa
aaatgcctacctgattctgccccatataaccctgattcaatacaaacaatactccaagac
gttaaagatcacattattccaggcctaacacattggcaaagtcctaacttttttgcatac
ttttcttcgacggcaagcactgctgggtttcttggtgaaatgctcacaactggattcaat
gtagtggggttcaattgggtttcatcgccggctgcaactgaactcgaacacttggtcatg
gaatggcttgcagacatgcttcagcttcccaagtcgtttcatttctctggtaatggtggt
ggtgtgttacatgggagtacttgcgaagccattgtttgcacaatggtagctgccagggac
caaatgctaagccaaattggtagcgacaatctgggaaaacttgttgtgtatggttcagac
caaacacacagcacacttcaaaaagctacccaaattgttggaatcaaaccagagaacttc
agggtcatcaagactacaaagtcagctgaatttgctctatcacctgaaatgctaagattg
acagtttgttcagacttggacaaagggctgctgccacttttcctatgtgccacaataggc
acaacctcaaccactgctatcgatccattggaggcactctgtgatgtagcaaaagaacac
ggcatttgggttcatgtggatgctgcatatgcaggaagtgcttgcatttgtccagagttt
cgtcatttcattgatggcgttgagggtgcaaactccttcagtttcaacccacataaatgg
ttatttactgcgatggactgttgctgcctttgggttaagaacccaagtgcattgatacgt
tcactgtcgacgaatccggagtatttgaggaacaaagccagtgattcaaagcaggtggtg
gactacaaagactggcaaatagcactaagccggaggttccgggcattgaagatgtggctt
ttgctaagaagctatggcgtagctaaccttagaagctttattcgaagccatgtcaagatg
gccaagatttttgaagtgctggtgagaatggacaacaggtttgagattgtggtgcctaga
aacttctccttggtctgtttcaggatttcaccatccgcaatagttagtgatgatcattct
tataatggtgaggagtacaatatggttaacgagatcaactgcaaattgctggaggccatc
aatgcatcaggctctgtgttcatgactcatgctgtggttggaggtgtctacctgctgcgg
tgcgcagttggtgcaactctaacagaggaaaaacacattgtcgaggcatggaaggtggtg
caaggtcaggcacatgcaattctctcagcatgcatagttgatctgcataatcctatgaga
tatcctaacatatag

DBGET integrated database retrieval system