KEGG   Fragaria vesca (woodland strawberry): 101306991Help
Entry
101306991         CDS       T02666                                 

Definition
(RefSeq) uncharacterized LOC101306991
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
fve  Fragaria vesca (woodland strawberry)
Brite
KEGG Orthology (KO) [BR:fve00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fve01001]
    101306991
Enzymes [BR:fve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101306991
Protein kinases [BR:fve01001]
 Serine/threonine kinases: TKL group
  IRAK family
   101306991
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Stress-antifung DUF3403 APH Haspin_kinase ABC1 TMEM154 Pkinase_fungal Tweety AEP1
Motif
Other DBs
NCBI-GeneID: 101306991
NCBI-ProteinID: XP_011461933
Position
LG3
AA seq 1312 aa AA seqDB search
MPYFPLQNTSILILFFLALFSLCSADDYLAHICPNTTTFTPNSTFQNNRDQLLSSLAPIN
ATRDTSFYQTSAGGTDTVEGLFLCRGDVPPDACRDCVRIAASEVVQRCPIEKQVVIWYDA
CMVRYSNQSFLSTAWQTPQLFMWRAASLMQTRVSKQFNQVLVHTMDVLVLKVINAALKFA
TQEANNITRLSTLYTLGQCTQDLSTADCRNCLKDAIAQLPSCCFEKKGGTVMYPSCNIRF
ELYPFYKSQVVKADSPPPSPASIANPPPTPPAGKSKLLFIVIPSILAPVALCVLVAVVVR
CFIHKSKGAKQQQNKAEVDMTTVESLQFDLGTIEAATKKFSGDNKLGEGGFGQVFKGTLD
NGQEIAVKRLSKSSGQGVREFKNEVLLVAKLQHRNLVRLLGFCLEGEETLLVYEYVPNKS
LDYFLFEAEKREQLDWSRRCTIIGGIARGILYLHEDSRLRVIHRDLKASNILLDANMHPK
VSDFGMARMFGIEDQTQGNTRRIVGTYGYMAPEYAMQGLYSIKSDVFSFGILLLEIISGR
NNFLGFHPTTSASTLLSYAWQLWNEGKVLELMDPLLKDSCSPNEFLRYILIGLLCVQEDA
NKRPTMSSVVLMLKSESISLPKPDRPAFFTGRCINDQSHTVRDLPGCSVNGLTVSDDIPH
LKMPYFPLKNTPILILFFLALLSLCSADDYLAHICPNTTTFTPNSTFQNNRDQLLSSLIS
NVTSDTGFYQTSAGGTDTVEGLFLCRGDVPPDACQDCVYNVASEVIQRCPIQKQVLIWYD
ECMVRYSNQSFLSTAWKEFSLYRWNDASGALVPQFNQTLEQTMNGLFQKVINAALKYATQ
EANITQLITLYTTGQCMRDLSTKDCMNCLTVARAQLPADCCYENLGGKVFFPSCYSRFEV
FAFYKLQVIYKADSPPPSPASIANPPPTTGKSKLLFIVIPSILAPVAFCVLVVVVARCFI
QKSKRAKQRQNKAEVDMTTVESLQFDVGTIEAATKKFSGDNKLGEGGFGQVFKGTLDNGQ
EIAVKRLSKSSGQGVREFKNEVLLVAKLQHRNLVRLLGFCLEGEETLLVYEYVPNKSLDY
FLFDSMKRAQLDWTGRKNIITGIARGILYLHEDSRLRIIHRDLKASNVLLDNEMNPRISD
FGMARIFAGSEGQANTAIIVGTYGYMAPEYAMEGLYSFKSDVFSFGVLLLEIITGRMNAG
FHRTTHASLPSYAWKLWNEGNGLELIDPLLVGSCDSDEFLRYLHIGLLCVQEDAYDRPTM
SSVVVNLKSETVNLSQPGKPAFSIGTFVDVHNKAGAVSSSYNGLTVSSIEPR
NT seq 3939 nt NT seq  +upstreamnt  +downstreamnt
atgccttactttcccttgcaaaatacgtcaatattgatcctgtttttcctcgcattgttc
agcttgtgcagtgctgatgattatctcgctcatatctgcccgaacaccacaactttcacc
ccaaactccactttccaaaacaaccgcgaccaactgctgtctagccttgcccctattaat
gccactcgtgacaccagcttttaccagacctcggccggcggaacagataccgtggagggc
ctcttcctctgccgcggtgacgttcccccagacgcttgcagagactgtgtgcgcattgca
gcctcagaagttgtccaacggtgtcccatcgagaaacaggttgtcatatggtacgacgca
tgcatggtacgctactctaaccagtcattcctttctaccgcgtggcagacacctcagctg
ttcatgtggagagcagccagtctgatgcagaccagggtaagtaagcaatttaaccaggta
ctagtacataccatggatgtgctagtcctaaaggttatcaatgccgctctaaagtttgca
actcaagaagcaaataatattacacggttaagtacgctgtacacccttggacagtgcacg
caggatctctccacggcagattgcaggaattgtcttaaagatgccatagcccaacttcca
tcttgttgttttgaaaaaaaagggggaacagttatgtaccctagttgtaatattaggttt
gagttgtaccccttctacaaatcacaggtagttaaagcagactctccacctccttcgcca
gcatcaatagcaaatcctccgccaaccccgccagcaggaaaaagtaaactcttattcata
gtcattcccagtattctggctcctgttgctctgtgtgtgcttgttgcggttgtggtcaga
tgtttcattcacaaatcaaaaggagccaagcaacaacaaaataaagctgaagttgatatg
acaactgttgaatccttgcaatttgacttgggaactattgaagctgccacaaagaagttt
tctggcgacaacaagttaggtgaaggcggattcggtcaagttttcaagggaacacttgat
aatggacaagaaatagctgtgaagaggctgtcaaagagctctggacaaggtgtacgagag
tttaagaatgaggttttattggtagccaagcttcaacaccggaatcttgtgaggcttctg
ggattttgcttggaaggagaggaaaccttacttgtctacgaatatgtgcccaacaaaagt
cttgattattttctatttgaagccgaaaaaagagaacaactggattggtcaagacgctgc
accattataggaggaatagctcgaggcatcctctatctgcatgaagattctaggcttcga
gttatacatcgtgatttaaaagctagcaatatcttgttagatgccaatatgcatcctaaa
gtttcagattttggaatggcaagaatgtttggaattgaggatcaaactcaaggaaacacc
cggagaattgttggcacttatggttacatggctccagaatatgcaatgcagggattgtat
tctataaaatcagatgtcttcagcttcggaatactcttgcttgagatcatatcgggaaga
aataactttttaggctttcatcccacaacttctgcatcgacacttctcagttatgcttgg
caattatggaatgaagggaaagtattggagttgatggatccgttgctgaaagattcatgc
agtccaaatgagttcttgagatacatcctcattggattattgtgtgttcaagaagacgca
aataaaaggccaaccatgtcgtctgttgttctgatgttaaagagtgaaagcatcagcctt
cccaaacctgatcgacctgcgttctttacaggaagatgtatcaatgatcagagccatact
gtacgggatttacctggttgctctgtaaacggtttaacggtttctgatgatatcccacac
ctcaaaatgccttattttcccttgaaaaatacgccaatattgatcctgtttttccttgcg
ttgctcagcttgtgcagtgctgatgattatctcgctcatatctgcccgaacaccacaact
ttcaccccaaactccactttccaaaacaaccgcgaccaactgctgtctagccttatttct
aatgtcaccagcgacaccggcttttaccagacctcggccggcggaacagataccgtggag
ggcctcttcctctgccgcggtgacgttcccccagacgcttgccaggactgtgtgtacaat
gtagcctcagaagttatccaacggtgtcccatccagaaacaggttctcatatggtacgac
gaatgcatggtacgctactctaaccagtcattcctgtctacggcgtggaaggaatttagt
ctgtacaggtggaacgacgcatctggagcgctggtaccccaatttaaccagacactagaa
cagaccatgaatgggctattccaaaaggttatcaatgccgctctaaagtatgcaactcaa
gaagcaaatattacacagttaattacgctgtacaccactggacagtgcatgcgggatctc
tccacgaaagattgcatgaattgtcttacagtggccagagcccaactgccagcagattgt
tgttatgaaaacttagggggaaaagttttctttccaagttgttatagtaggtttgaggtg
ttcgccttctacaaattacaggtaatttataaagcggactctccacctccttcgccagca
tcaatagcaaatcctccgccaaccacaggaaaaagtaaactcttattcatagtcattccc
agtattctggctcctgttgctttttgtgtccttgttgtggttgtggccagatgtttcatt
caaaaatcaaaacgagccaagcaacgacaaaataaagctgaagttgatatgacaactgtt
gaatccttgcaatttgacgtgggaactattgaagctgccacaaagaagttttctggcgac
aacaagttaggtgaaggcggatttggtcaagttttcaagggaacacttgataatggacaa
gaaatagctgtgaagaggctgtcaaagagctctggacaaggtgtacgagagtttaagaat
gaggttttattggtagccaagcttcaacaccggaatcttgtgaggcttctgggattttgc
ttggaaggagaggaaaccttacttgtctacgaatatgtgcccaacaaaagtcttgattat
tttctatttgattcaatgaaacgtgcacaacttgattggaccggacgtaaaaacattatt
actggaattgcaaggggaattctctatttacatgaggactctcgccttagaatcatccac
agagacctgaaagctagcaatgtattgttggacaatgagatgaacccaaggatctcagat
tttggaatggctaggatctttgcaggaagtgaaggacaagctaacactgctattatagtt
gggacttatggatacatggctccagaatatgcaatggagggactatattctttcaagtct
gatgtctttagctttggagtactcctgcttgagataataactgggagaatgaacgctggc
tttcatcgaacgacgcatgctagcctcccatcatatgcatggaaattatggaatgaagga
aatggactggagctaattgatccattgctggttggttcgtgtgattcagatgagtttttg
agatatcttcatattggattgttgtgtgttcaagaagatgcatatgacaggccaaccatg
tcttctgttgttgtaaatttgaagagtgaaactgtaaatcttagccaacctggaaaacct
gcattctccattggaacattcgttgatgtacataataaggctggtgctgttagtagctct
tataatggactaacagtttccagcatagaaccacggtaa

DBGET integrated database retrieval system