KEGG   Fragaria vesca (woodland strawberry): 101307779Help
Entry
101307779         CDS       T02666                                 

Definition
(RefSeq) fructan 6-exohydrolase-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
fve00052  Galactose metabolism
fve00500  Starch and sucrose metabolism
fve01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101307779
   00500 Starch and sucrose metabolism
    101307779
Enzymes [BR:fve01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     101307779
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Fur_reg_FbpA
Motif
Other DBs
NCBI-GeneID: 101307779
NCBI-ProteinID: XP_004297561
Position
LG4
AA seq 593 aa AA seqDB search
MAVMIFSLRMIIFLISLLIFFAVIELEGSADACSSFLKFELPSTRQAREPYRTGYHFQPC
KNWMNDPNGPMVYKNVYHHFYQYNPDGVAWSPNIVWAHSTSTDLVNWTPHDEALYPSEPF
DINGCWSGSATILPGEKPAMFYTGINSQTEQVQNLAFPKNLSDPFLREWIKIPQNPLMMP
TQANQIIVDSFRDPTTAWLGSDNRWRLVIGSRKNQTGLAILYTSEDFLNWTMASHPFHSA
KENGMWECPDFFPVSKSTPIGLDTSTNGADVKHVLKISLFDIAKEYYTIGTYNLDKDVYI
PDQGSVESDSGLRFDYGKFYASKSFFDSVKNRRILWGWSNESSSAEDDIKKGWSGLQTIP
RTILLDKSGKQLVQWPIEELEKLRTEHVKLPSSLIKGGSLHEVLGVATTQADVEVTFEIS
NFEKAEVLDQSWTDPQILCSNKDASVDGSLGPFGLLVLASEGLQEYTAVFYRIYKSHNNK
YVVLMCSDQSRSSLNENNDKTTYGAFVNVDPVHEKLSLRSLIDHSIVESFGGEGKVCITA
RVYPTLVVDGDTRLYAFNYGRESVEISGSAWSMETAMINRSREEEYDRTEESW
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atggccgtgatgatattctctcttcggatgatcatctttcttatttcacttttgattttc
tttgctgttattgagcttgaaggttccgccgatgcttgcagcagctttctgaaatttgaa
ctaccttcaacccgccaagctagagagccttacagaactgggtatcatttccagccttgc
aagaattggatgaacgatcctaatgggccaatggtttacaagaacgtataccatcatttt
tatcaatataatcccgatggtgtagcatggtcacccaacattgtttgggcacattcaaca
tcaactgatcttgtcaattggacaccacatgatgaggccctctacccatcagaaccgttt
gatatcaatggttgttggtcagggtctgctacaatcctccctggggagaagccagccatg
ttctacaccggaatcaactcccaaactgagcaagttcaaaacttggcattccccaaaaac
ctctcagacccttttcttagagaatggataaaaatcccacaaaacccactaatgatgcca
acccaagctaaccaaataatcgtagactcatttagagacccaactactgcttggctagga
tcagataatagatggagattagtcattggaagcaggaaaaaccaaactggcctcgctatt
ctgtatacgagcgaagatttcctaaactggaccatggcaagccacccctttcattcagca
aaagaaaatggaatgtgggagtgcccagattttttcccagtttcaaagagtaccccaatt
ggtcttgacacatcaacaaatggtgcagacgttaaacatgtgctcaagattagcttgttt
gatattgccaaagagtactacacaattgggacatataaccttgataaggatgtctatatc
cccgatcagggatcagtggaaagtgactcgggtttgagatttgattatggcaagttttat
gcatcaaaatccttctttgacagtgttaagaaccgaaggatcttatggggctggagtaat
gaatcctcaagtgcggaggatgacatcaagaagggctggtctggactccagacgattcca
aggaccattttgctagataagtctgggaaacaattggtccaatggcccattgaagaactt
gaaaagctgagaacagaacatgtcaagttaccaagctctttgattaagggaggatcacta
catgaagtacttggagtcgcaacaacacaagcagatgttgaagttacatttgagataagt
aattttgagaaagcagaggtgctagatcaaagttggacggatccacaaattctatgtagc
aataaggatgcctcagttgatgggagtctaggaccattcgggttgctggttttggcttca
gagggtttgcaagaatacacagcagtcttttatagaatatacaaatctcacaacaacaaa
tatgtggtgctcatgtgcagtgatcaaagcaggtcttccttaaatgaaaataatgataag
accacatacggggcttttgtaaatgttgatcctgttcatgagaagctatcactcagaagc
ttgattgatcattctatagtggagagctttggtggagaaggcaaagtgtgcataacagcc
cgagtttatcccacattggttgtagatggtgatacccgcttatatgctttcaattacggg
agagagagtgtagaaatctcaggaagtgcgtggagtatggaaaccgcaatgattaaccga
tcaagagaagaagaatatgatcgaacagaagagagttggtaa

DBGET integrated database retrieval system