KEGG   Fragaria vesca (woodland strawberry): 101307880Help
Entry
101307880         CDS       T02666                                 

Definition
(RefSeq) putative ATP-dependent RNA helicase DHX33
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
fve03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:fve00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    101307880
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:fve03041]
    101307880
Enzymes [BR:fve01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     101307880
Spliceosome [BR:fve03041]
 Complex C
  Other components
   Step II factors
    101307880
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C AAA_30 AAA_22 DEAD T2SSE DUF2075 AAA_19 FtsK_SpoIIIE ABC_tran PhoH
Motif
Other DBs
NCBI-GeneID: 101307880
NCBI-ProteinID: XP_011463009
Position
LG4
AA seq 714 aa AA seqDB search
MAHGRLNNSANGQKRSFSDENRKPDDFAKKQKLTQHRKSLPIASVEKRLVEEVRKHDTLI
IVGETGSGKTTQLPQFLYNAGFCGYGKVIGVTQPRRVAAMTVAKRVAEECGVALGEKVGY
SVRFDDVTSSSTRIKYMTDGLLLREALLDPYLSKYSVVIVDEAHERTVQTDVLLGLLKNV
QNARAKVVNNHLDTKNKKTSNDMQLDKENGSQTFSFLKQCQGKNPLKLIIMSASLDARIF
SEYFGGARAVHIQGRQFPVDIYYTHHNVQDYLDAALTAIFQIHMEEDPGDVLVFLTGQEE
IESVQRLVKERLKQLPETSQKLVAVPIFSSLPSEQQMQVFAPAPDGFRKVILATNIAETS
VTIPGIKYVIDPGFVKARTYDPNKGLSSLNVIPISKAQALQRSGRAGRERSGKCFRLYPE
NQFEKLEDSTKPEIKRCDLASIILQLKVLGVDDVIGFDFIDKPSRSAIVKSLEQLYVLGA
LTDECKLSEVGRQMASLPLDPIYSKALIRASETEFNCLEEMLITVAMLSVESIFFAPREK
LNEARIAMKCFASPDGDHLTLVNVYRAFSEFSEKRSDLSKEKHEKSIRKWCKDNFINSRS
LKHARDIHSQIRGNVEQMGLHVASCGDDMLPFRRCLAASFFLNAALKQPEGTYRALANGQ
VVRIHPSSVLFHEKPECVVFNELVETNHKYIRNTTRIDYLWLHELAPHFYAMQN
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggctcacggacggctcaacaactccgccaacggccaaaaacgcagcttctccgacgag
aatcgtaaacccgacgacttcgccaagaagcagaagcttacgcagcacaggaagtctctg
ccgatcgcttctgttgagaagcgtctcgtagaggaggtacgaaagcatgacactttgatt
attgttggtgaaaccggaagcggaaaaacaacgcaattaccgcagtttttgtacaatgct
ggattttgtgggtatgggaaagtcattggggtgactcaacctaggcgtgtggctgctatg
actgtggcaaagcgggtggctgaggaatgcggtgttgctttgggtgaaaaggttggttat
tctgtgagatttgatgatgtgacctctagttcaacgaggatcaagtatatgacagatgga
ttgctactgagggaagcattattggatccatatctatctaagtattcagttgtcattgtc
gatgaagctcacgagagaactgtccagactgatgtcttactcggcttgcttaaaaatgta
caaaatgcaagggcaaaagttgtgaataaccacctagatacaaaaaacaagaaaacaagt
aatgacatgcagttggataaagaaaatggttcccagacttttagtttcttgaagcaatgc
caaggaaagaatccattgaagttaattatcatgtctgctagtttggatgcacgaattttc
tccgagtactttggtggtgcaagagctgttcacatccaaggtcgacaatttcctgtcgat
atatattatactcatcataatgtacaagattatctagatgcagcgttaactgccatattt
cagattcatatggaggaggaccctggtgatgtacttgtatttttgactggtcaagaagaa
attgaatctgtacagagacttgtcaaagagagacttaaacagttacctgaaacaagtcaa
aaactagtagctgttcctatattctcatctcttccatcagaacagcaaatgcaagtgttt
gcaccagctcctgatggatttcgtaaggtaatattggcaacgaatatcgctgagacatct
gtcacaatacctggaatcaagtatgttatagatcctgggttcgtaaaagcacgtacctat
gatccgaataaagggttatcaagtttgaatgttattccaatttcaaaagcgcaggctctt
cagaggagtgggcgtgcagggagagagagatcagggaagtgcttccgcctctacccagaa
aatcaatttgagaaacttgaggattcaacaaagccagagatcaagcggtgcgacctcgct
agtataattctgcaacttaaggttctgggcgttgatgatgtcattgggttcgacttcata
gataaaccttcaaggtcggctattgtcaaatcactggagcaattgtatgtgctaggtgct
ttaacagatgagtgcaaactgtcagaagttggacgtcaaatggcaagccttccgctagac
cctatttactcaaaagctctaatccgagcaagtgaaactgaattcaattgccttgaagag
atgttgataactgttgcaatgctctcagtcgagtctatatttttcgctccccgtgagaaa
ttaaacgaggccagaattgccatgaagtgctttgcaagtccagatggggaccacctcact
ttggttaatgtatatcgagcgtttagtgagttctcagagaagagatcagatctcagtaaa
gagaaacatgaaaaaagtatcaggaaatggtgcaaggacaatttcattaatagtcgctcc
ctgaagcatgctcgtgacatacatagccaaatccgaggaaatgttgaacaaatgggtctt
catgtagcttcctgcggggatgacatgcttccgtttcgaagatgtcttgctgcctctttc
ttcctcaatgcagcattaaaacagcctgagggaacatacagggctttagcaaatggtcag
gtggttcggatccatccttcgtctgtgttgttccatgagaaaccagagtgtgtagtattt
aatgaattagtcgaaactaatcataaatacatccgcaacacaactagaatcgattatttg
tggttacatgagcttgctcctcatttctatgccatgcagaattga

DBGET integrated database retrieval system