KEGG   Fragaria vesca (woodland strawberry): 101308273Help
Entry
101308273         CDS       T02666                                 

Definition
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
fve03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:fve00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    101308273
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:fve03041]
    101308273
Enzymes [BR:fve01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     101308273
Spliceosome [BR:fve03041]
 Complex C
  Other components
   Step II factors
    101308273
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 Helicase_C S1 DEAD AAA_22 AAA_19 AAA_30 DUF2075 T2SSE ABC_tran PhoH AAA_14 AAA_16 Flavi_DEAD
Motif
Other DBs
NCBI-GeneID: 101308273
NCBI-ProteinID: XP_004296169
Position
LG3
AA seq 1090 aa AA seqDB search
MDVDVKKLEKLSLISKVCSELETNLGPQHGDKILAEFITDLGQNSKSVEEFNAKLKENGA
AEIPDYLVRNLLTIIHAVLAPEKNPRSSKREDDKPKDRSRESRGSKGEEDKPRDRRRESR
GNEDQAYNSGEPELYGVYKGMVTRVMDTGCFVELSSLRGKEGLVHVSQMEKRRVSNAKDV
VKRGHQVYVKVVSISGQKLSLSMKDVDQKTGKDLLPITRSSGYDTRNSNPLMSRDGTASR
TSLSGIRIKEDSLVQSCRPRKRLSSPERWEIKQLIASGVLNAKDYAEIYQDEEVDSIMMV
YKDEGPEEELEIELNEEAPAFLQGHDMYSVDMSPVKIFKNPEGSLSRAAALQSALVKERR
EMRDQQQRAVLDSIPKDLNRPWEDPMPENGERHLAQEIRGVGLSAHDVPEWKKEAYGKAI
SFGNRSSLSIQEQRKSLPIYKLRKEVIDAVNENQVLVVIGETGSGKTTQLTQYLAEAGYT
TKGRIGCTQPRRVAAMSVAKRVAEEVGCRLGEEVGYAIRFEDCTGPDTVIKYMTDGMLLR
EILFDKDLMQYSVIMLDEAHERTIHTDVLFGLLKQLVNRRPDLRLIVTSATLDAEKFSGY
FNNSKIFTFEGRTHPVDVMYVKEPESDYLDAAIITVLQIHLQEPEGDILLFLTGQEEIDF
ACQVLYERMKALPKNIPELIILPVYSALPSEMQSRIFDLAPPGKRKVVVATNIAEASLTI
DGIIYVIDPGFAKQNVYNPKLGLDSLVITPISQASAKQRAGRAGRTAEGKCYRLYTVSAF
KNEMRPTTVPEIQRTNLASTVLAMKAMGINDLLSFDFMDPPTPQSLISAMEKLYSLGALD
EEGFITRLGMKMSEFPLEPPLSKMLLASVDLGCSDEILTIIAMIQTGNVFYRPREKQDRA
DQKRAKFFQPEGDHLTLLAVYQAWKGKNYSTPWCFENFLQSRSLRRAQDVRKQLMSIMDK
HRLDVVSAGNNYTKITKAITAGFFFHVARKDPQEGYKTFVENQPVYIHPSSALFQKQPGW
VIYNELVMTTKEYMREVTAIDPKWLVELAPRFFKAADPNKMTKRKRQQRIEPLYDRYNEP
NSWRLSRRRG
NT seq 3273 nt NT seq  +upstreamnt  +downstreamnt
atggatgttgatgtcaagaagctagagaaactttccttgatttcgaaagtctgttcggaa
cttgaaaccaatctagggccgcagcatggagacaaaattctagctgagttcataacagat
ctgggacagaacagcaaaagtgtggaggaattcaatgccaaattgaaggaaaatggcgct
gccgaaatccctgattacttagtccgtaatcttctcactatcattcatgcagttcttgct
ccggagaagaacccgagatcttccaaaagagaagacgataagcctaaagatagaagcaga
gagagcagaggttctaagggagaagaagacaagcctagagatagaagaagagaaagcaga
ggtaatgaggatcaagcgtacaattccggtgagccagagttgtatggtgtttataagggc
atggttacaagagtgatggatacaggctgctttgttgagttgagttctctcagagggaag
gagggtctggttcatgtttcgcagatggagaagaggcgagttagtaatgctaaagatgtg
gtgaagaggggtcatcaagtttatgtgaaggtggtttcgatttcaggtcagaagttgagt
ctttcaatgaaagatgttgatcaaaagacagggaaggatttgcttcctattacgaggagt
tcaggctatgatactcgtaactccaacccgttaatgtcaagggatggtactgcgagcagg
actagtctttctgggattaggattaaggaggatagtcttgtccagtcttgtaggccaagg
aagagactaagctccccggagaggtgggaaatcaaacagttgattgcttcaggtgttttg
aatgctaaagattatgcagagatttatcaagacgaggaagtggatagtataatgatggtc
tataaagatgagggacctgaggaagagcttgaaattgagctcaatgaggaagcgccggcc
tttttgcaagggcacgacatgtattctgtggatatgtcgccggtgaagatctttaagaat
ccagaaggatcactgagccgtgctgctgcacttcaatctgcgctggtcaaggagcgtaga
gagatgcgtgatcagcagcaaagagctgtgctggattctataccgaaggatttgaatcgt
ccgtgggaagatccaatgccagagaatggtgagaggcatcttgcacaggaaattagaggt
gttggtttgtcagctcatgatgtacctgagtggaagaaagaagcttatgggaaggctatt
agtttcgggaacaggtcaagcctttcgattcaggaacaaaggaagagcttgcctatctac
aagctgaggaaagaagtgattgatgcagtgaatgagaatcaagtacttgttgtcattggt
gagactggttctggcaagacaacacagctaacccagtatcttgcagaagcaggttacacg
acgaagggtagaattggatgtacacagcctcgtagggtggcggcaatgtcagtagcgaaa
agggttgctgaagaggttggctgtcggttgggggaggaagtcggttatgccattcgtttt
gaggattgcactggaccagatactgtcatcaagtacatgacagatggtatgcttcttagg
gagattttgttcgataaagaccttatgcaatattcagtgataatgcttgatgaagctcat
gagaggacaatccacacagatgttctatttggattactgaagcaactcgtgaaccgcaga
ccagaccttcgtttgattgttacctctgctactttggatgcagaaaagttttcaggttat
ttcaacaattccaagatctttactttcgaggggagaactcatccagttgatgtaatgtat
gtcaaggagccagaaagtgattaccttgacgcggctattatcactgttttgcagattcac
ttgcaagagccagaaggtgacatccttctcttcttgactggacaggaagagattgatttt
gcatgccaggttctttatgagaggatgaaagctcttcctaaaaatatacccgagttgatc
atcttaccggtttatagtgctcttccgagtgaaatgcagtctaggatatttgatctagct
ccaccagggaagaggaaagtagttgtggctactaatattgccgaggcatctctgactatt
gatggaataatttatgtcattgatcctggatttgcaaagcagaatgtttataacccaaag
ctggggctagattcactggtcataactccaatctcacaagcatcagccaagcaacgagct
gggcgtgccgggcgtacagccgaggggaaatgttaccgtctctacactgtgagtgccttc
aaaaatgagatgcgtcctactacagtccccgaaatccagaggacaaatcttgcgtctacg
gtgcttgcaatgaaagctatggggataaatgatctcctctcttttgattttatggatcct
cctacgccgcagtcactcatttcagccatggagaaactgtacagcttaggagcacttgat
gaagagggtttcataaccagactaggaatgaaaatgtctgagtttcctctagaaccaccc
ctctcgaagatgctactcgcaagtgtggacctcggatgcagtgatgagatcttgaccatc
atagcaatgattcagacaggcaatgtgttttacaggcctagggagaaacaagaccgcgct
gatcagaagagagcaaagtttttccagccagaaggagaccatcttactttacttgcagtc
taccaggcttggaaaggaaaaaactattcaacaccatggtgtttcgaaaactttcttcag
tctcgctccttgaggcgcgcgcaggatgtccgaaaacagctcatgagcatcatggacaag
cacaggctggatgttgtcagtgccggaaacaactacacaaagatcaccaaggcaatcacg
gccggctttttcttccatgtagctagaaaggatccacaggaaggttacaagacctttgta
gagaaccagccagtgtacatccacccaagcagtgctctctttcagaagcaaccaggttgg
gtcatctacaatgagctggttatgactacaaaggagtacatgcgagaggtgacagccatt
gatcccaaatggcttgtggagttggctcccaggttcttcaaagctgcagatcctaacaag
atgaccaagcgcaagcgtcaacaacgtatcgaacccttgtatgacagatataatgaaccc
aactcatggcgccttagtagacgccgtggttga

DBGET integrated database retrieval system