KEGG   Fragaria vesca (woodland strawberry): 101309897Help
Entry
101309897         CDS       T02666                                 

Definition
(RefSeq) protein disulfide-isomerase
  KO
K09580  protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
fve04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:fve00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101309897
Enzymes [BR:fve01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     101309897
Chaperones and folding catalysts [BR:fve03110]
 Protein folding catalysts
  Protein disulfide isomerase
   101309897
Membrane trafficking [BR:fve04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    101309897
Exosome [BR:fve04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   101309897
  Exosomal proteins of colorectal cancer cells
   101309897
  Exosomal proteins of bladder cancer cells
   101309897
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_2 Thioredoxin_7 AhpC-TSA Thioredoxin_8 OST3_OST6 Glutaredoxin Redoxin ERp29_N
Motif
Other DBs
NCBI-GeneID: 101309897
NCBI-ProteinID: XP_004290881
Position
LG2
AA seq 498 aa AA seqDB search
MTSSRVLLCFSLLVALCFTAIHADEADSKEFVLTLDSSNFSDTISKHDFVVVEFYAPWCG
HCKKLAPEYEKAASILSSLDPPVILAKVDANEEANKGLATDYDVKGFPTIKILRDGGKII
QEYKGPREADGIVSYLKKQSGPASVELKSADDATTLVGEKKIVVVGVFEKFSGDEYEKFL
SLAQKLRSDYEFGHTLDAKHLPRGDSSVTGPVVRLFKPFDELFVDFKEFNAEALEKFIEE
SSLPVVTEFNNDPDNHPFVIKFFNGQNDKAMLFLNFSSDAADAFKSKYREVAEKYKGEGI
SFLVGDLEASQGAFQYFGLKEDQVPLIIIQTNDGQKFLKPHLEPDHISVWVREYKDGKVP
AYKKSEPIPEKNDEPVKVIVAESLEDMVSKSGKNVLLEFYAPWCGHCKKLAPILDEVAVR
FEKDPEVLIGKYDATANDVPTEFDVKYYPTLYFKTASGKLLSYDEDDRSKESLIAFIEKN
KDKAETKTENQESSKDEL
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcctctagagttttgctctgcttctctttgctcgtcgctctctgcttcaccgcg
atccacgccgacgaggctgattccaaggaattcgtcctcactctcgacagctccaacttc
tctgacactatcagcaagcacgacttcgtcgtcgtcgagttctacgccccatggtgtggc
cactgtaagaagctcgctccagagtatgaaaaagctgcatctatcttgagcagtctcgac
ccaccagtcattcttgcgaaagttgatgcaaatgaggaagcaaacaaaggacttgctact
gattatgatgttaagggtttccccacaatcaagattctaagagatggtgggaagattatc
caggaatacaagggtcctcgtgaagccgatggtattgtttcttatttaaagaaacaaagt
ggtcccgcttctgttgaactaaagagtgccgatgatgcaactactcttgttggtgaaaag
aagattgttgttgtcggtgtgtttgagaagttctctggagacgagtatgagaagttcttg
tctctagctcagaaattgcgttcagattatgaattcggtcacactcttgatgcaaagcac
ctaccccgtggtgattcatctgtgactgggccagtagttaggctgttcaagccattcgat
gaactttttgttgatttcaaggaattcaatgcagaggctctagagaagtttattgaagaa
tctagcttgccagttgttacagaattcaacaatgacccagacaaccacccttttgtgatc
aagttcttcaacggtcaaaatgataaggctatgttgtttctgaacttcagcagtgatgct
gctgatgcttttaaatcaaagtaccgtgaagttgctgagaaatacaaaggagaaggcata
agctttttagttggagatctagaggctagtcaaggtgccttccagtactttggacttaaa
gaagaccaggtgcctctgatcatcatacagaccaatgacggacaaaagtttttgaaacca
catttggagccagaccatatttctgtttgggtgagggaatacaaggatgggaaagtacca
gcatacaagaaatctgaacccatccctgagaagaacgatgagcctgtaaaagttatagtc
gctgagagcctggaggacatggtttccaagtctgggaaaaatgtgctgcttgagttttat
gccccatggtgcggacactgcaagaagcttgcaccaatcttggatgaagttgctgtgcgc
ttcgaaaaagatcctgaagttcttatcggaaaatatgatgctactgcaaatgatgtccca
actgagtttgatgtgaaatactatccaactttgtacttcaagacagcaagtggaaagcta
ttgtcctatgatgaggatgacagatccaaggaaagcctcattgctttcattgaaaagaat
aaggacaaagctgagactaaaactgagaaccaggagtcctcaaaagatgagctctaa

DBGET integrated database retrieval system