KEGG   Fragaria vesca (woodland strawberry): 101314222Help
Entry
101314222         CDS       T02666                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
fve00010  Glycolysis / Gluconeogenesis
fve00562  Inositol phosphate metabolism
fve01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101314222
   00562 Inositol phosphate metabolism
    101314222
Enzymes [BR:fve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     101314222
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     101314222
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 101314222
NCBI-ProteinID: XP_004307683
Position
LG7
AA seq 495 aa AA seqDB search
MVMAKLLSLLLLFSVFFLHSNAGEEEAFDVRQHLSTVSRYGVVKDVADNSFVASEIPDGC
TPIHLNLVARHGTRSPTKKRMKEMDNLAPRLASLVKEAEEQKQPLQNLPAWLREWESPWK
GKQNGGQLTVQGEEELYELGIRTRERFPHLFDEDYHPNVYAIKSSQIPRASASAVAFGMG
LFSGKGNLGPGRHQAFAVTSESRASDIVLRFHDCCDNYKDYRKSQEPSVTKLKEPVFDEI
TSALKRRYKLNFSRQDTSSLWFLCKQEASLLNVTDQACALFSPSEVALLEWTDDLEAFIL
KGYGKALNYRMGVPLLKDVVQSMDQAIEAHEEKHDPGTYEKARLRFAHAETVVPFSCLLG
LFLEGSEFQQIQREQPLEHPPKPPQKRNWKCSNMAPFGGNNMLVLYSCPANSSSKYFVQV
LHNEQPIPVPGCDGSDLCPLDDFKEKVVAPHLKHDYNAVCNTKGGQQEQKPATSKLSQLF
RWLFSNRIVPTHDEF
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggttatggctaagcttctcagtctgctactacttttctccgtcttcttcctccattca
aatgccggagaagaagaagctttcgacgttcgccaacacctctctactgtgtccagatac
ggcgtcgttaaagacgtcgctgacaattcatttgtagcatctgaaattccagatggatgc
actcccattcacttgaatcttgtggcaaggcatggaactcggtctcctacgaagaaacgg
atgaaggagatggacaacctggcacctcgtctggcttcgttagtgaaggaagctgaagaa
cagaaacagcctttgcaaaaccttcccgcttggttaagggaatgggaatcgccttggaaa
ggaaaacagaatggtggacaattgactgtccagggagaggaagagctctatgaattagga
attaggactagagaaagattcccgcatttgtttgatgaggattaccatccaaatgtgtat
gccatcaagtcatctcaaatccctcgggcatcagccagtgctgtggcatttggcatgggg
ttgttcagtggcaaaggaaatcttggtccaggcagacatcaagcttttgctgtaaccagt
gaaagccgtgcgagtgatatagtgttgaggttccatgattgttgcgataactacaaggac
tatcggaaaagtcaggagccatctgttactaagcttaaggaaccagtctttgacgaaatt
acttctgcattaaaaaggcgctacaagttgaacttttcaaggcaggacacatcatcactc
tggtttctttgcaaacaggaggcgtccttgttgaatgtaaccgatcaagcttgtgcgctt
ttcagcccctctgaggttgctttgctggaatggacagatgatttggaggcctttatattg
aaggggtatggtaaagctttgaactatagaatgggggttcccttgcttaaagatgttgtg
caatctatggatcaggctattgaggcccacgaagaaaaacatgatcctggcacttatgaa
aaggcaaggctgaggtttgcacacgcagaaactgtggttccattttcatgcttgctcggg
ctttttcttgaaggatctgaatttcaacaaatacagagggaacagcccttggaacaccct
ccaaagcctccccagaaaagaaattggaagtgcagcaatatggcaccttttggtgggaat
aacatgcttgtactgtacagctgtccagccaacagttcaagcaagtactttgtgcaagtg
ttgcacaatgagcaacccattcctgtgcctggttgtgatggttctgacctttgcccactt
gatgattttaaggaaaaagtagttgctcctcatttgaagcatgactacaatgcagtatgc
aatacaaaaggaggacagcaggagcaaaagcctgcaaccagtaagttatctcaactgttc
cgttggcttttctcaaacaggattgttcctacccacgatgaattttag

DBGET integrated database retrieval system