KEGG   Fragaria vesca (woodland strawberry): 101314412Help
Entry
101314412         CDS       T02666                                 

Definition
(RefSeq) nitrilase-like protein 2
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
fve  Fragaria vesca (woodland strawberry)
Brite
KEGG Orthology (KO) [BR:fve00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    101314412
Enzymes [BR:fve01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     101314412
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-GeneID: 101314412
NCBI-ProteinID: XP_004307441
Position
LG7
AA seq 312 aa AA seqDB search
MSFCLSLPNSRITPPTSPIPPKSSAGASNMAANSLRVAAAQMTSINDLAANFATCSRLVK
EAAASGAKLICFPESFSFIGAKDGDSLKIAEPLEGPVMQQYCSLARESGIWLSLGGFQEK
GSDDEHLFNTHVVVDDGGNIRITYRKIHLFDVDTPGGRSYKESIITEAGKNVVAVDSPVG
RLGLTVCYDLRFPEIYQLLRFQHEAQILLVPSAFTKVTGQAHWEILLRARAIETQCYVIA
AAQAGKHNDKRESHGETLIIDPWGTVVGRLPDTLSTGITIADIDFSLIDSVRAKMPIAKH
RKPVEFWKSASL
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgtcattttgtctctcactacccaactctcgcatcactccacccacctctccgattcct
cccaagtccagcgccggcgcgtccaacatggcggccaactccctccgagtcgccgccgcc
cagatgacctccatcaacgacctcgccgccaacttcgccacctgctcccgcctcgtcaaa
gaggcagctgctagtggagcaaagttgatttgcttccctgaaagcttctcctttataggt
gctaaagatggggatagtctcaaaatagctgagcctttggagggtccagtaatgcaacag
tactgctctcttgcaagggagtctgggatttggttgtcactaggagggtttcaggagaag
gggtctgatgatgagcatttgtttaacactcatgttgtggttgatgatggtgggaatatt
agaatcacttacagaaagattcacttgtttgatgtggatactcctggtgggaggtcatac
aaggaaagtatcattacagaagcagggaagaatgttgttgcagtagatagccccgtgggt
cgcttgggtttgacagtttgctatgacctgagattcccagagatataccagctgctcagg
ttccaacatgaggcacagattctgttggtaccttcagcctttaccaaagtaactggtcag
gcacattgggagattcttcttcgtgctcgtgcaattgagactcaatgttacgtaatagct
gctgcacaagcgggaaagcataacgataaaagagaaagccatggtgaaactttaattatt
gatccatggggaacagttgttggtcgactgcctgatacgctgtcaactgggattactata
gctgatattgatttctccttgatcgattcagtgagagcaaagatgccgattgccaagcat
cggaaacccgttgagttctggaaatcagcatctctatga

DBGET integrated database retrieval system