KEGG   Fragaria vesca (woodland strawberry): 101314541Help
Entry
101314541         CDS       T02666                                 

Definition
(RefSeq) poly [ADP-ribose] polymerase 2
  KO
K10798  poly [ADP-ribose] polymerase [EC:2.4.2.30]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
fve03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:fve00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    101314541
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:fve03032]
    101314541
   03036 Chromosome and associated proteins [BR:fve03036]
    101314541
   03400 DNA repair and recombination proteins [BR:fve03400]
    101314541
Enzymes [BR:fve01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     101314541
DNA replication proteins [BR:fve03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     101314541
Chromosome and associated proteins [BR:fve03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    101314541
DNA repair and recombination proteins [BR:fve03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     101314541
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP PARP_reg WGR SAP
Motif
Other DBs
NCBI-GeneID: 101314541
NCBI-ProteinID: XP_011459796
Position
LG2
AA seq 615 aa AA seqDB search
MANKLKVDQLRDQLAQRGLSTAGTKPVLVSRLESALLQDNNQTADAGDGSVTKKRGRNSN
EDEDSAASEKIKATEKFRSMNIKQLREEATLRGVAATGSKKELLERLCEDSGKDSDDIAA
TKAKEEGNDSKEKMVTATKKGSAVLDQWLPDHIKTHYHVLQLGDDVYDAMLNQTNVGHNN
NKFFVLQVLQSDDGSSFMVYYRWGRVGVKGQNKLLGPYTRDKAIDEFEKKFSDKTRNDWS
DRKTFQSFPKCYVWLEMDYSEKEGQSAVAEKNGPALVAQPSEIKLDPRIAKFVSLICNVA
MMKQYMMEIGYNADKLPLGKLSKSTILKGYNILKSIADVIDQSDRRMLEQLSNFVIDTPQ
KLKQKLEMVEALGEIEVATKLLNDDTGTQEDPLYSNYQSLRCDLIPLGADSDEFDMVSKY
LHNTHAKTHSNYTVDIVQIFRASREGEAERYRKFLSMKNRMLLWHGSRLTNWAGILSQGL
RIAPPEAPVTGYMFGKGIYFADMFSKSANYCYAKNSIKAGVLLLCEVALGDMAELLTAKY
DADKLPEGKLSTKGVGGTEPDLSEAQLLEDGVMVPLGKPKENPRKGALLYNEYIVYNVDQ
IRMRYVVQVNFNFKR
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atggccaacaagctcaaagtagaccagctccgggaccaattggcccagcgcggcctcagc
accgccggaaccaagcccgtcctggtctcgaggctcgagtccgctcttctccaagacaac
aaccaaacggcagacgccggcgacggttcagtgactaaaaaaaggggacggaactccaat
gaagacgaggattcggccgcgtcggagaaaatcaaggcgactgagaaattccggagtatg
aatatcaagcaactccgcgaagaggcaactctccgcggagttgcggctaccggctccaag
aaggagttgctcgagcggctttgtgaagattccgggaaggattccgatgacattgctgca
actaaagcgaaagaagaagggaatgacagcaaggagaagatggttactgctaccaagaaa
ggttcggcggtgttggatcagtggctgccggatcacattaagacacattatcatgttttg
caactgggtgatgatgtgtatgatgccatgttgaaccagaccaatgttggccataacaat
aacaagttctttgtgctccaagttcttcaatccgatgatggtagtagtttcatggtttac
tatagatgggggagagtaggtgtcaagggtcaaaacaagttactaggcccttacacccga
gacaaagcaatcgatgaatttgaaaagaaattctctgacaaaaccaggaatgattggtct
gaccgaaaaacattccagtcattcccaaagtgctatgtgtggttagaaatggattatagc
gaaaaggaaggtcaatcagctgttgcagaaaagaatggcccagctttagtagctcaacct
tcggaaataaaacttgatccccgtattgcaaagtttgtatctcttatctgcaacgttgcc
atgatgaagcagtatatgatggaaataggatacaatgctgataagttgccactggggaag
ctgagcaaatcaacaattctaaagggttataacatcctgaagagtatcgctgatgtgatt
gaccagtctgatagaagaatgcttgaacaattaagtaattttgtgattgatactcctcag
aagttgaagcaaaagttggaaatggttgaagcactcggtgaaattgaagttgcaacaaaa
ttgttgaacgatgatactgggacacaggaagatcccttgtactctaattaccagagcctc
cgctgtgatctgataccgcttggcgccgattcagatgaatttgatatggtttcaaagtat
ttgcataatacccatgcaaagacgcattcaaattatactgttgatatcgttcagatattt
cgtgcatcgagagagggtgaagctgaacgttacagaaagtttttaagtatgaaaaataga
atgcttctatggcatggctctcgtctcacaaattgggctggcattttatctcaaggtttg
cgcatagctccacctgaagctcccgtaactggttacatgtttgggaaagggatttacttc
gccgacatgttctccaaaagtgcaaactattgctatgctaaaaattctataaaagctggt
gtgctgctgctgtgtgaggttgcactgggtgacatggctgagcttttaactgccaaatat
gatgctgacaagttaccagaaggaaagctaagcacaaagggagttggtggaactgaacca
gatctttccgaagctcagttactagaggatggtgttatggttcccctaggaaagccaaag
gagaatccacgcaagggtgctttactttacaacgagtacatagtttacaatgtcgaccag
attcggatgcgctatgttgttcaagtgaatttcaatttcaagagatag

DBGET integrated database retrieval system