KEGG   Fragaria vesca (woodland strawberry): 101314994Help
Entry
101314994         CDS       T02666                                 

Definition
(RefSeq) heat shock cognate 70 kDa protein-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
fve03040  Spliceosome
fve04141  Protein processing in endoplasmic reticulum
fve04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:fve00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    101314994
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101314994
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101314994
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fve01009]
    101314994
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:fve03041]
    101314994
   03009 Ribosome biogenesis [BR:fve03009]
    101314994
   03110 Chaperones and folding catalysts [BR:fve03110]
    101314994
   04131 Membrane trafficking [BR:fve04131]
    101314994
   03051 Proteasome [BR:fve03051]
    101314994
   03029 Mitochondrial biogenesis [BR:fve03029]
    101314994
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fve04147]
    101314994
Protein phosphatases and associated proteins [BR:fve01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     101314994
Spliceosome [BR:fve03041]
 Complex B
  Other components
   Prp19 complex
    101314994
 Complex C
   Prp19-CDC5 complex
    101314994
Ribosome biogenesis [BR:fve03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    101314994
Chaperones and folding catalysts [BR:fve03110]
 Heat shock proteins
  HSP70 / DNAK
   101314994
Membrane trafficking [BR:fve04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    101314994
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    101314994
Proteasome [BR:fve03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    101314994
Mitochondrial biogenesis [BR:fve03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    101314994
Exosome [BR:fve04147]
 Exosomal proteins
  Proteins found in most exosomes
   101314994
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl DUF1464
Motif
Other DBs
NCBI-GeneID: 101314994
NCBI-ProteinID: XP_004307524
Position
LG7
AA seq 522 aa AA seqDB search
MQAGAAGRAIGIDLGTTYSCVAVWEHEQGHVEIIVNDQGNRTTPSYVAFTDTESLVGDAA
FNQILRNPTNSIFDAKRLIGRKFSDDSIQGDVKLWPFKVIEGPEDKPMIVVTYQEQEKQF
TAEEISSMVLTKMRKIAEAYLGSTVTNAVITVPAYFNNSQRQATKDAGATAGLNVMRIIN
EPTAAAIAYGIDKKANWHGKRNVMIFDLGGGTLDVSLLTIGDGDFEVKATAGETHLGGED
FDNRLVNYCVEQFKRKTNADLAGNSRALRRLRNECEKAKRRLSFSATTEIEIDCLDKDND
FYVTITRAKFEQLNMDFFNKCMEPVEKCLRDANLDVDSVDDVVLAGGSSRIPKVQQLLEN
VFRGKELCKGINPDEAIAYGAAVQAAVLSGYEIEKLQDFTLLDVIPLSLGVEIRVPSTGD
EHCMQVVIPRNTRVPIKVNITLWTTYDNQVEAVFGIYEGESSTTLNNNFLGKFVLQGIPP
APAGCVSFDVCFDMDANGILSVSAQDTCTGQKKGITIISKKQ
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcaggagcagcaggccgtgcaattggaattgatctggggactacatattcgtgt
gtagcagtgtgggagcacgagcagggtcatgtagaaatcatagtgaatgatcagggaaat
agaactacaccatcttatgttgcgttcactgatactgagagcttagtaggggatgcagca
tttaaccaaatcctgagaaatcccaccaactcaatctttgatgctaaaaggttaattggt
aggaaattcagtgacgattctattcaaggcgatgtgaaactttggccattcaaggtcatt
gaaggtcctgaagataagcctatgattgtggttacctatcaggaacaggaaaagcaattt
actgctgaagaaatctcatccatggttctcacaaagatgcggaagattgctgaggcatac
cttggatcaacggtgacaaatgcagtcatcactgtccctgcttacttcaataactctcaa
cgccaggctacaaaagatgcaggtgccactgctggcctaaatgtgatgcgcatcattaat
gaaccaactgctgcagccattgcttatggtattgacaagaaggccaattggcatggcaag
agaaatgtgatgatatttgatttaggtggaggtactttagacgtgtcattacttacaata
ggtgatggtgattttgaagtgaaagccactgctggagagactcatcttggaggtgaagac
tttgataatagattggtgaattactgtgtcgagcaattcaagaggaagacaaatgcagac
cttgctggaaactctagagctcttaggaggttgagaaatgaatgtgagaaggcaaagagg
aggctttcattttcggctacaactgagattgaaattgattgcttggataaagacaacgat
ttttatgtgaccattacacgtgccaaattcgaacaactgaacatggatttcttcaacaag
tgtatggagcctgtggagaagtgtttgagggatgcaaacttggatgtagacagtgttgat
gatgttgttcttgctggtggctcttccagaattccaaaggtgcagcaacttttagagaat
gtgttcaggggaaaggagctatgtaagggcattaatcctgatgaggcaatagcatatggc
gctgctgttcaagctgcggtgttgagtggatatgagattgagaaacttcaagatttcact
ctcttggatgtaatccctctatcacttggggttgagattagggtgccgagtacaggtgat
gaacattgtatgcaggttgtgattccaagaaacaccagagttcccataaaagtgaacatc
acattgtggactacgtatgacaaccaagttgaagctgtatttggaatctacgagggtgag
agctcaacaaccttaaataataactttttgggtaaatttgttcttcagggcattcctcca
gctcctgctggatgtgttagcttcgatgtttgctttgatatggatgcaaatggcattcta
agtgtgtctgctcaggatacgtgtaccggccagaagaaagggatcactatcatcagtaag
aaacagtga

DBGET integrated database retrieval system