KEGG   Fragaria vesca (woodland strawberry): 105350324Help
Entry
105350324         CDS       T02666                                 

Definition
(RefSeq) G-type lectin S-receptor-like serine/threonine-protein kinase At1g61500
Organism
fve  Fragaria vesca (woodland strawberry)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr S_locus_glycop Haspin_kinase Pkinase_fungal APH
Motif
Other DBs
NCBI-GeneID: 105350324
NCBI-ProteinID: XP_011460339
Position
LG3
AA seq 240 aa AA seqDB search
MFPTQLLGFNSKSGTRNVMTSWKSENDPSTGRFLVALSAQTPSQLFIWVNNGLNSAPYWR
SGPWDKSRLIGIPEMNAQYRSGFTLDDNAEQGSKYLKWATQLSEILAYQVISSEDPMRRA
ALDWPLRFKIIQGVARGLLYLHHDSCLKIIHRDLKVSNILLDEKMNAKISDFGLARIVQE
TPDLENTQRVVGTLGYMSPEYALEIISGKKNTSFYLLDQEQGSLAYAWNLWNEGNGTGIG
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgttcccgactcagctgctgggtttcaatagcaaatctgggacgaggaatgtcatgact
tcctggaaaagtgaaaatgatccatcaactggcagattcttggttgcattgtcagcacaa
acgccatcacaactgtttatttgggttaataatggactgaattcagcaccctattggaga
agtggtccatgggataagtcgaggttaattgggatacctgaaatgaatgctcaatatcga
agtgggtttactctggatgataatgcggagcaaggatcaaagtacttaaaatgggctaca
cagttgagtgaaatattggcttatcaagtaatctcttctgaagatccaatgagaagagca
gcgttggattggcctctccgcttcaagattattcagggcgttgctagaggacttctttat
ctccatcacgattcctgtttgaaaataatacatagagatctgaaagttagcaacattctc
ttggatgagaaaatgaatgcaaaaatttcagattttggattggcacgtattgttcaagag
acaccggatttagaaaatactcagagggttgtgggaacacttggttatatgtctccggag
tatgccctggagattattagcggaaagaagaatactagcttctatttacttgaccaagaa
caaggctctctagcctatgcatggaacttatggaatgaaggcaacgggactggcattggc
tga

DBGET integrated database retrieval system