KEGG   Fusarium verticillioides: FVEG_00083Help
Entry
FVEG_00083        CDS       T04869                                 

Definition
(RefSeq) serine/threonine protein kinase
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
fvr  Fusarium verticillioides
Brite
KEGG Orthology (KO) [BR:fvr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fvr01001]
    FVEG_00083
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fvr03036]
    FVEG_00083
Enzymes [BR:fvr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     FVEG_00083
Protein kinases [BR:fvr01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   FVEG_00083
Chromosome and associated proteins [BR:fvr03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    FVEG_00083
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pox_ser-thr_kin Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 30058478
NCBI-ProteinID: XP_018742085
UniProt: W7LKD9
Position
1
AA seq 1068 aa AA seqDB search
MPDFSDVFEKHWSFFPVEFKTHSTRQRELLSRQILPIKYCKSFREENSGFEAALHKVQID
PDYCDLVPKDTPLVFKIYKGYKMSEDYNLETENYSNLNGKAQHAITKCYGSFSCEETDFR
VIILEYASEGSLRNFFRNIHPPVHAEEFQELWVNLVGLLDGLDALHTYHSSKQGRIHQDI
KPDNILVFPNSAKSRFDARFKLTDFHVTEFKQLDREGKMTIDNWGSRLYSAPECYANFPA
QFNVRPLVSPNIDLWALGAVFSEILVWSISGYTVLETFRKARQKEISTLTYIEARGIDAC
YHDGHERLPTVDRFLKDVLEHRRATDEVSPAISHMILNFMMTNERERLRAVEIKSLMQSI
TATVHQTNSSTYEAQVAKIRQSRLEESSSIIATSSDHIGLSDASSLRLWSDPEHTAGDTS
LSTAPNTRDTGSGHKNQKGDPRIIEVYGYGSQPLHGDLETEDQKEIQSLASQDDHIDSLQ
SGITPLRVYQIASKLLVERFLDDDHLLDLYQQAVKRLDRTRFVNNHRILMKQYFLDLRAT
ARSRAEEMSVDFLRSRKERIRISSVIYDLVLNQGEQVRRIFKMEIKDDQESILLVDRFLA
AQEIYDHDRATGSDPESSDSSEDLSPEQEQTSQGEASKIEAVAIFMTAGSAFDSYKCHLD
EFLHPKKLESDYREAIEPLMVSSEDCSTTPVDSQDATKTGVVDASVVKPETSPAAVETAS
PFVKQLVKGYSWLIKITRPRVKEGYRRLEWTCDCGSQLYADFLVLDEERFRRFAESLQSP
PPKSSHEMIANAQSSQASSSRERESPVSNRDSPNINSHLLSSSSARPSGADTSSEAIPRS
SSERGQRDHPAESPKSKAKYLALCIQTGTIYTTLEEAETSTFKLDAELLKEMKDVYTRIR
GVRSKRNSLFIPIRLEYVKFMLWNKRQGYISITERPKSVPPEEDLQYDFAPLDAWPPMPD
EVFFHYLEKGEEKCFQDRHWIPRLAVRRDNRIIEGHEASFGWGIHIIEGPNRWAIFALFL
VTVFGSALAALLWSTIHNDIQGGTGLGQLIIALSSAILTASLFRLGYL
NT seq 3207 nt NT seq  +upstreamnt  +downstreamnt
atgccggacttttctgatgtttttgagaaacattggagtttcttccctgtcgagttcaaa
actcactcaacccgacagcgagaactactgtctcgccaaatcttgcctattaaatattgc
aaatcattcagggaggagaatagtgggttcgaagcggctctgcataaggttcagatagac
cctgactactgtgacctggtgccaaaggacactccgctcgtgttcaagatttataaagga
tacaaaatgagtgaagattataatctcgagactgaaaactattcgaatctgaacggcaaa
gcgcagcacgctatcaccaagtgctatggttccttttcctgcgaggaaacagatttccgt
gtcattatcctcgaatacgccagtgaaggaagcctacgtaatttctttcgaaatattcat
ccacctgtccatgctgaggaatttcaagagctttgggtcaacttggtaggactcttagat
ggactcgatgctcttcacacgtaccacagttcaaaacaagggagaatccaccaagacatc
aagccagacaatatcctggtgtttccaaattctgcgaaatcccggtttgatgctcgattc
aaactgacagacttccatgtgacagagtttaaacagttggacagagaagggaagatgacg
attgacaactggggaagtcgattgtatagtgctccggagtgctacgccaacttccccgct
caatttaatgtcaggccgctggtttcaccaaatattgacctttgggctcttggggcagta
ttcagtgaaatcctggtctggtcgatctctggatatactgttctggagacatttcgaaag
gcaagacagaaagaaatctcaactctgacttacatcgaggcaagaggaattgatgcttgc
taccatgatgggcatgagaggctgcctaccgttgaccgatttctcaaggacgtacttgaa
caccgaagagcgactgatgaggtgtcacccgctatcagccatatgattcttaatttcatg
atgacgaatgagagggaacgattgcgtgcggtagagataaagtctctcatgcaaagtata
acagcaacagttcaccaaaccaactcatctacgtatgaagctcaggttgcgaaaattcgt
caatctcgattagaagagtcgtcctcgatcattgcaacttcgtccgaccatattggtttg
tcagacgcatcttcattacgactctggtcagatccggaacatacagctggtgatacgtca
ttatcgaccgctccaaatacgcgagacacaggttcagggcataagaaccagaagggagat
ccgaggattatagaagtctatggatatggaagtcaaccactccacggggacttggagaca
gaagatcaaaaagaaatccagtctcttgcctcccaagatgatcacatcgattctcttcag
tctggtattactcctttgagagtttatcaaattgcctccaagttactggttgagcggttc
ttagacgatgaccacttacttgatttataccaacaagccgttaaacgactggataggaca
cgtttcgtcaacaatcacaggatcttgatgaaacaatatttccttgaccttcgagcaact
gcaagatctcgcgccgaggagatgtctgtagatttcctgcggagccggaaagaaaggatc
cgaatctcctctgttatttatgatctcgttctcaaccaaggcgagcaggtccgcaggata
ttcaagatggaaatcaaggatgaccaagaaagcatcctcctagttgatcgttttctggcc
gcgcaagagatctatgaccatgatcgtgcaactggctcggatccagaatcttctgattcc
tcagaagacctgtctccagaacaggaacaaaccagtcaaggagaagcgtcgaaaatcgaa
gcagtggccattttcatgactgccggatcggcatttgactcttataaatgccacttggat
gagttcctgcacccaaagaagcttgaaagcgattaccgagaggccatcgagccactaatg
gtgagctctgaggactgcagtacgacgccggttgattcgcaagatgccacgaagactgga
gtcgtggatgcttcagttgtcaagccagagaccagcccggctgctgttgaaacggcttcc
ccttttgtaaaacagctcgtaaagggatattcctggttaattaagatcactcgaccgaga
gtaaaggagggctaccgccgcctcgaatggacatgtgactgcggatctcagctctatgca
gactttcttgtgttagacgaagagcgattccggcggtttgccgaatcgctacaaagcccg
ccaccaaaaagcagccacgaaatgatagcgaatgctcagagctcgcaagctagctcttcc
agagaacgggagagtccggtctccaaccgggatagtccaaacatcaattctcatcttctg
tcatcgagttctgcgcggccctctggggctgatacgtctagtgaagctataccgcgatcc
agttccgaaaggggacagagggatcatccagcggagtcaccaaagtccaaggcaaaatat
cttgcactttgtattcagacaggcacgatatacacgactctcgaagaggccgaaacttca
acctttaagctcgacgcagagttacttaaagagatgaaagatgtctataccaggattcgg
ggtgtaagatctaaacgcaactctctttttatacctattcgtttggaatacgtcaagttt
atgctttggaataaaagacagggctacatatcaataaccgaaagacccaaaagcgtgcct
cccgaggaagaccttcagtatgactttgcccctctcgacgcctggcctcctatgccggat
gaggtcttctttcactaccttgaaaagggagaagagaagtgttttcaggaccgccactgg
attcctaggcttgctgttcgccgagacaacagaataatcgaaggccacgaagcctctttt
ggctggggcattcatattatcgagggaccaaatcggtgggctatctttgcattatttctt
gtcaccgtgtttggaagtgccctggctgctctcctttggtctactattcacaatgacatt
cagggcggaacagggctagggcaattaataatagcattatcatcggcaattctgacggcg
tctttgtttagattagggtacttatag

DBGET integrated database retrieval system