KEGG   Fusarium verticillioides: FVEG_02055Help
Entry
FVEG_02055        CDS       T04869                                 

Definition
(RefSeq) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
fvr  Fusarium verticillioides
Pathway
fvr00450  Selenocompound metabolism
fvr00970  Aminoacyl-tRNA biosynthesis
fvr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fvr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    FVEG_02055
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    FVEG_02055
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:fvr01007]
    FVEG_02055
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:fvr03016]
    FVEG_02055
Enzymes [BR:fvr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     FVEG_02055
Amino acid related enzymes [BR:fvr01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   FVEG_02055
Transfer RNA biogenesis [BR:fvr03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    FVEG_02055
 Prokaryotic type
   Other AARSs
    FVEG_02055
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 Anticodon_1
Motif
Other DBs
NCBI-GeneID: 30060296
NCBI-ProteinID: XP_018745237
UniProt: W7LKL3
Position
6
AA seq 667 aa AA seqDB search
MASKSPVLPEEGKRNILITSALPYVNNIPHLGNIIGSVLSADVFSRYCRARGWNTIYVCG
SDEYGTATETKALEEGLSPADLCAKYHALHKGVYDWFRIDFDIFGRTPTQQQTQIVQQIF
KELWKNGYIEERETTQPFCSHPAHGKFLADRFVEGECSICHDPGARGDQCDACGSLLDPF
EPEREPSTSDDDHVEAKATGFLINPRCKVDGTTPEKRKTKHLFLRLDAVKDLLVPWFHKS
SKEGDWSTNCISITQSWIDKGLLPRGITRDLKWGVPIPRDLEGLSNEEYAEKVFYVWFDA
CIGYVSITKNLVDGDNLDGTNWEKWWKNPENVKLYQFMGKDNVPFHTIIFPASQLGTGEN
WTKVHKMSTTEYLNYEGGKFSKSRGVGVFGNTAKETGVDPDVWRYYLLSRRPESADSEFK
WQEFIDCNNNDLLKNLGNLNQRILKFTQAKLDGVVPDYTKYTDERLEEHKKEVNEALKTF
ISQFDAIKLRAGLATVMHISALGNKLLQDSKLNNQLLADEPDRCAAVIGLGINHLQLLAS
IVHPYMPSTSEAILEQIGSPGLISIPETWSGDLVKPGQKIGEPKLLFTQIPASKLDEWRE
AFGGEEIRKQKALEAEKAAAKKAAKDKKKQKKLALRQAEKAGEASTEEKPVEASAVDLLP
DNKPSET
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaaaatcacccgttctgcctgaggagggtaagcgcaacattctaattaccagt
gcccttccctacgtcaacaacattccgcatctgggcaacatcatcggcagtgttctctcc
gccgatgtcttttctcgctattgcagagcgcgaggctggaacaccatctacgtttgtggt
tccgacgagtacggtactgctaccgagacaaaggccctcgaggaaggtctttcgcccgcc
gacctttgcgccaagtatcatgcccttcacaagggagtctacgattggttccgaattgac
ttcgatatcttcggccgaacacccactcaacaacagacccagattgtgcagcagatcttt
aaggagctctggaagaatggttatattgaggagcgagagactactcagcctttttgctcg
catcctgcccacggcaagttcctcgcagatcgattcgtcgagggagaatgcagcatttgc
catgaccccggagcacgcggagatcaatgcgatgcctgcggtagccttctcgacccattt
gaacccgaacgcgagcccagcacctctgatgatgaccatgtcgaggctaaagcgactggt
ttcctgatcaacccccgctgcaaggtcgatggaaccacccccgagaagcgaaagacgaag
caccttttccttcgcctagacgcggttaaggacttgcttgttccctggttccacaagagt
agcaaggagggagattggagcacaaactgtatttccatcacccagtcatggatcgacaag
ggactccttccccgtggtatcactcgagacctcaagtggggtgttcctattcccagggat
ctcgaaggcttgagtaacgaggagtatgcagagaaggtcttctatgtttggttcgatgct
tgcattggctacgtctctatcaccaagaacttggtcgatggtgataacttggatggcacg
aactgggagaagtggtggaagaaccctgagaacgtcaagctttaccagttcatgggcaag
gacaatgtaccatttcacactatcatcttccctgcctctcaacttggaacaggagagaac
tggaccaaggtccacaagatgtcgacaaccgagtatctcaactatgagggcggaaagttc
agcaagtcccgcggcgttggagtttttggaaacactgctaaagagactggcgttgatcct
gatgtttggcgatactaccttctatccagacggcccgagtccgctgactctgagttcaaa
tggcaagagttcattgactgcaacaacaacgatcttctcaagaacctcggtaacttgaac
caacgaatcctcaagttcactcaggccaagttggatggcgtcgttcccgactacacaaag
tacaccgacgagcggctagaggagcacaagaaggaagtgaacgaggccctcaagaccttt
atctcacagttcgacgccatcaagctccgcgctggccttgccaccgttatgcacatctct
gcccttggcaacaaacttctgcaggacagcaagctgaacaaccagcttctggccgatgag
ccagaccgctgcgctgcggtgattggtcttggtatcaaccatctccagctccttgcaagc
atcgttcatccttacatgccctctacttccgaggccatcctggagcagatcggcagccct
ggcttgatctccattcctgagacatggtcaggagacctcgtcaagcccggccaaaagatt
ggcgagcccaagcttctcttcacacagatccctgcgtctaagcttgatgagtggcgcgag
gcctttggtggtgaggagatccgaaagcaaaaggccctcgaggcagagaaggcggcggcg
aagaaggctgctaaggacaaaaagaagcaaaagaagctcgctcttcgtcaagctgagaag
gccggtgaagcttctaccgaggagaagcctgttgaggcctctgctgttgacctgctcccc
gacaacaagccctctgagacatag

DBGET integrated database retrieval system