KEGG   Fusarium verticillioides: FVEG_02069
Entry
FVEG_02069        CDS       T04869                                 

Definition
(RefSeq) nitrite reductase [NAD(P)H]
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
fvr  Fusarium verticillioides
Pathway
fvr00910  Nitrogen metabolism
fvr01100  Metabolic pathways
Module
fvr_M00531  Assimilatory nitrate reduction, nitrate => ammonia
fvr_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:fvr00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    FVEG_02069
Enzymes [BR:fvr01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     FVEG_02069
SSDB
Motif
Pfam: Pyr_redox_2 NIR_SIR Fer2_BFD Pyr_redox Rieske Rieske_2 NIR_SIR_ferr Rubredoxin_C NAD_binding_7 FAD_binding_2
Other DBs
NCBI-GeneID: 30060307
NCBI-ProteinID: XP_018745260
UniProt: W7LUE1
Position
6
AA seq 1089 aa
MAATAQKRVVVVGLGMVGIAFIEKLLKYDAKSKEYAITVVGEEPYLAYNRVGLTTFFEHR
KVEELYMNPAEWYTEAGSSLNCHINTKATHINTEDKFIECANGESYPYDILVLATGSDAI
LPRMLKGWDANGVFVYRTIEDLNRLIKFSTDKKGTNGAVVGGGLLGLEAAKAMLDLETFN
RVDVIEKAQWVLTRQVDETGGKMVADQVSQLGVNLNLGKGVSSMKTDENNNLTGVIFDDG
SEISCSTLCFAVGVKPRDDLARSANLEVGQRGGIVVNDDLRTSMPDIYAIGECASWRGMA
YGLIAPGVAMAEVVAFNLTQAKLHSPQTFKTPDMSTKLKLLGVNVASFGDCFADRDGPVT
LPPKYARTLVNGDAKEPKSVQALTYKDPFSNVYKKYIFTKDGKYLLGGMMIGDVCDYVKL
LPMVKAQKELEISPSELILGAKKDGGEDTDDLDDDAQVCSCHNVTKGDIVKVVKDGTCKD
VASIKKCTKAGTGCGGCVPLITTIFNKTMASMGQEVTNYVCSHFNHSRADLFNIIMVKRL
KNMGEVMREAGNDKEALGCELCKPVVASIMASLWNRHVMDKTTHGLQETNDRFLGNIQRD
GTYSVVPRVSGGEITPDKLVVIGEVAQKYNLYTKITGGQRIDLFGAQKQDLLDIWGQLVA
GGMESGHAYAKSLRTVKSCVGSTWCRFGLSDSVGMAVRLEERYKSIRAPHKIKGGVSGCV
RECAEAQGKDFGLIATEKGWNIFVGGNGGANPRHAELLAKDVPPADVVTILDRYLMFYMR
TADKLQRTARWIENLPGGIKYLQEVILEDKLGINASLEAQMEELVDSFFDEWAEAIKSPA
IAAKFKQFANTNDTTRNMELEDDRGQKRPAFWPADAAATDNFSGLKDKWSMTSWEPIIES
SYFDGADELPNGISATIKRGDTQLAIWRIKGVYYATQQMCPHKRAFILSDGLIGQEPNKA
VTSGDKDGASPWVSCPHHKRNFDLGNGACKTDESLSIATFPTEARADGMLYLKLPPVEEL
DAALGTKKWMVKKGEAGEAPLAKLDSKIKFVGLRGKKPYVKPTGGAKMTTKPLDLMMAAN
GCGGGAPEW
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggctgcaacagcacaaaaacgtgtggtggtcgttggcctgggtatggtgggcattgct
ttcatagaaaagctgctcaagtatgacgccaaatcaaaagaatatgcaatcacagtcgtt
ggagaagaaccatatctcgcctacaaccgagtaggactcacaacattcttcgagcaccga
aaggtcgaagaactatacatgaacccagcagaatggtacacagaagctggaagctcatta
aactgccacatcaacacaaaagccacacacatcaacaccgaggataaattcatcgagtgc
gcaaacggcgagagctacccctacgacatcctcgtcctcgccaccggttcagacgctatt
cttccccgtatgctcaagggctgggacgcaaatggtgttttcgtctaccgcacaatcgaa
gacttgaacaggcttatcaagttctccaccgacaagaagggcaccaatggagctgtcgtt
ggtggtggtcttctcggtcttgaggcggcaaaggccatgctcgatcttgagacctttaac
agagtcgatgtcattgaaaaggctcagtgggttctcacaaggcaggtcgacgagactggt
ggtaagatggtagcggatcaggtctcgcagcttggtgtgaacctcaatctcgggaagggc
gtatcgagcatgaagactgatgagaacaacaacctcactggagttatctttgacgatggc
tcagagatcagctgctcgacactatgcttcgctgttggtgtcaagccaagagatgacctc
gctagaagcgccaacctcgaggttggacagcgcggtggtatcgttgtcaacgatgacttg
agaacgagtatgcccgatatctacgccattggagagtgtgctagctggcgtggtatggct
tacggtcttatcgctcctggtgtggccatggccgaagtcgtcgctttcaacctcacacaa
gccaagcttcacagcccccagaccttcaagacccccgatatgagcacaaaactcaagctc
ctcggagtcaacgtcgctagtttcggtgactgcttcgctgatcgtgatggtcctgtgacg
cttcctcccaaatacgccaggacactcgtcaatggtgacgctaaagagcccaaatctgta
caagctcttacatacaaagaccccttctcgaatgtgtacaagaagtacatctttactaaa
gatggaaagtatctcctcggtggtatgatgattggcgacgtctgtgactacgtcaagctt
ctaccaatggtcaaggcgcagaaggagcttgagatttctcccagtgaactcattctcggc
gccaagaaggacggcggtgaggatactgatgatcttgacgacgatgctcaggtgtgctcg
tgccacaacgtcacaaagggcgatattgtcaaggttgtcaaggatggcacttgcaaggac
gttgccagtatcaagaagtgcacaaaagccggcaccggctgtggaggttgtgttcctctc
atcaccaccatcttcaacaagacaatggcttctatgggccaggaggtcaccaactacgtc
tgctcacactttaaccactctcgagctgacctgttcaacatcatcatggtcaagcgcctc
aagaacatgggtgaagtgatgcgcgaggctggaaacgacaaggaggctcttggttgcgag
ctgtgcaagcctgtggtagcgagcatcatggcttcgctgtggaacaggcacgttatggac
aagaccacccacggtctccaggagaccaatgatcgcttcttaggtaacatccagcgagac
ggtacctactctgtcgtcccccgtgtatccggtggtgagattactcctgacaagcttgtg
gtcatcggcgaggttgcccagaagtacaacctctacacaaagatcacaggtggtcagcgt
atcgacttgtttggtgcccagaagcaggatcttctcgatatctggggccagcttgttgct
ggtggtatggagtctggtcacgcttatgccaagtctctgcgaaccgtcaagagttgcgtt
ggttctacatggtgtcgattcggtctgagtgacagtgtcggtatggccgttcgtctggag
gagcgatacaagagtattcgagcccctcataagatcaagggtggtgtgagtggttgtgtg
cgagagtgtgctgaagctcaaggcaaagatttcggtttgattgccacagaaaagggctgg
aacatcttcgtcggcggtaacggtggtgcgaaccctcgccatgccgagcttctagccaag
gatgtgcccccagctgatgtcgtgacaatcctcgaccgatatctcatgttctacatgcgc
acagccgacaagcttcagcgaacagcccgctggatcgagaacctccccggtggtatcaag
tacctccaagaggtcatcctcgaggacaagctcggcatcaatgcctcgctcgaggcgcag
atggaagaacttgtcgacagcttcttcgacgagtgggctgaagctatcaagagccctgcc
atcgctgccaagttcaagcagttcgccaacacaaacgacacaacacgcaacatggagctt
gaagatgaccgtggtcagaagcgaccagctttctggcccgcggacgctgcagctacagac
aacttctcgggtctcaaggacaagtggtccatgacttcttgggaacccatcatcgaatct
tcatactttgacggtgctgacgagttgccaaacggtatctccgccactatcaagcgtggt
gacacgcagctcgccatctggcgcatcaagggcgtctactacgctactcaacagatgtgt
cctcacaagcgtgcattcatcctctccgacggtcttatcggccaagagcccaacaaggct
gtgacgagtggtgataaggatggtgcttcaccctgggtctcatgtcctcaccacaagcgc
aactttgacctcggcaacggtgcttgcaagacagacgagtctctctccatcgccacattc
cctaccgaggctcgagccgatggtatgttgtacctcaagcttccccctgtggaggagctt
gatgctgccttgggcacaaagaagtggatggtcaagaagggcgaggctggtgaggcgcct
ctcgctaagcttgacagcaagatcaagtttgttggattgagaggaaagaagccatatgtc
aagcccactggtggtgctaagatgactactaagccacttgacctcatgatggcagcgaat
ggttgtggcggcggtgcaccggaatggtag

DBGET integrated database retrieval system