KEGG   Fusarium verticillioides: FVEG_04715Help
Entry
FVEG_04715        CDS       T04869                                 

Definition
(RefSeq) aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
fvr  Fusarium verticillioides
Pathway
fvr00970  Aminoacyl-tRNA biosynthesis
fvr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fvr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    FVEG_04715
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:fvr03029]
    FVEG_04715
Enzymes [BR:fvr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     FVEG_04715
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     FVEG_04715
Mitochondrial biogenesis [BR:fvr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    FVEG_04715
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-GeneID: 30062756
NCBI-ProteinID: XP_018749286
UniProt: W7M691
Position
4
AA seq 617 aa AA seqDB search
MSRISTSILSRYLLKGQVPRQGCISTRHASRHTSLPSAAIAIANTTRRLHAAPEVVTPCP
EQPVPLRKQLKDEAKKAKKQGKKKPKGDSQTVHGWELTVGIEIHAQLNTARKLFSPAVTS
FNDEPNSHVALFDVAMPGSQPLFQKETLIPALRAALALNCEVQEVSRFDRKHYFWWDQPS
GYQITQYYEPFAKNGHITLLARDGISPQDGESVTIGIKQVQLEQDTAKTLAQAGKVQWLD
FNRVGVPLIEIITEPELHHPRTAAVLVRKIQMLLNTVDACVSGMETGGLRADVNVSVRRT
DGSNPSLGTRTEIKNLSTIKAVEDAIIAERDRQIRELEAGRSIPSETRGWSIGSTETRRL
RGKEGEVDYRYMPDPDIAPLVIGNDLVGHLRQSLAVTPDSELDTLIARFGLTAKDALSLI
NLENGSRVQYYYKVLHSIQGKFSEDFSEAEMPEVKSYSALVGNWIIHELGRLTTYKAGPL
AARDLTFTPQGDCEQVPDSDLSQLLYHLIRKQITGKVAKELLFAIYLKEIEGGVTQAITE
NDLWFNEIPEEEYEQLADEAMEGEHKILEEFASSETFPQGKLMFLVGKMMRLGPTERIVP
ANAERVMRAKVEGLRDR
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgaatatcaacgtctatcctcagcaggtatctgttgaaaggacaggtacctcgt
caagggtgtatcagtacgcgccatgcatccagacacacatcactaccatcggcagcgata
gccatcgccaatacgacaaggcggctgcatgctgctcctgaagttgtcacaccatgtccc
gagcaaccagtgcctttacggaagcagctcaaggatgaagccaagaaggccaagaagcaa
ggcaaaaagaagccaaagggtgattctcaaactgttcatggctgggaattgaccgttggt
atcgagattcacgctcagttgaacactgcccgcaagttattctcgccagctgtcacatct
ttcaacgatgaacccaatagccatgttgctcttttcgatgttgctatgccaggaagccag
cccttattccaaaaggaaaccttaattcccgctttgcgtgcagccttggccttgaactgc
gaagtccaagaggtcagtcgatttgaccggaaacactatttctggtgggatcagccctct
ggataccagatcactcaatactatgagccctttgccaagaatggacatattacgcttcta
gctcgagatggaatttctcctcaagatggcgaaagtgtgacgatcggaatcaagcaggtt
cagctcgagcaggatactgccaagacgctggctcaggctggcaaggttcaatggctcgac
ttcaaccgtgttggtgttcctcttattgagattattactgagcccgaacttcaccaccct
cgtactgctgccgtccttgtgcgaaagattcagatgctgttgaataccgtcgatgcctgc
gtatcgggtatggaaacaggaggtctgcgagctgatgtcaacgtttctgttcgacgaact
gatggatcaaacccatctctcggcacaagaaccgaaatcaagaacctgagtaccatcaaa
gcggttgaggacgctatcattgcagagcgtgaccgtcaaatccgcgagttagaagccgga
cgctctattcccagtgaaactcgcggttggtctatagggtctactgaaacacggcgactg
cgtggaaaagagggcgaagttgactatcgatatatgccagaccctgatatcgcgcctctt
gtcattggaaacgaccttgtaggccacttgcgtcagtccctggctgtcactcctgattcg
gagctggacactctgattgcccgatttggtcttacggccaaggatgcgttgtctctgatt
aacctggagaatggctcacgtgttcaatactactataaggtccttcactccatccagggc
aagttttcggaagatttcagcgaggccgagatgcccgaggtcaagagctattctgctctg
gtgggtaactggatcatacacgaacttggccgtctgactacctacaaggctggcccactt
gcagcccgagatctgacattcacgccacaaggagactgtgagcaagttcctgactcagac
ctgtcacagctcctttatcatctgatacgcaaacaaatcacgggcaaagttgccaaggaa
cttctctttgccatctatctaaaggagatcgaaggtggagtcactcaggcaattacagag
aacgatttgtggttcaacgagattcctgaagaggaatatgagcagttggctgatgaggcc
atggaaggagagcacaagatcttagaagagttcgctagctcagagacatttcctcagggc
aagctcatgttccttgtgggaaagatgatgcgactcggacctactgagcgcattgttcct
gcaaatgctgaacgtgtcatgagggcaaaggtagagggtcttcgagaccggtga

DBGET integrated database retrieval system