KEGG   Fusarium verticillioides: FVEG_04790Help
Entry
FVEG_04790        CDS       T04869                                 

Definition
(RefSeq) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
fvr  Fusarium verticillioides
Pathway
fvr00480  Glutathione metabolism
fvr00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:fvr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    FVEG_04790
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    FVEG_04790
Enzymes [BR:fvr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     FVEG_04790
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 30062827
NCBI-ProteinID: XP_018749411
UniProt: W7M6N4
Position
4
AA seq 278 aa AA seqDB search
MYVCNSDWFLRFIPCHSTTNSTATVPVPVPGPTYLMSLWRATAPRWLTLQPSSSSSSRWL
NKYYTTTATTSSRSPRFSPLNTKHNHSSPHQRNITHNHFRQLSTTAKMASATSFYDFKPL
DKRGQEVPLADYKGKVVLIVNTASKCGFTPQYAGLEKLWTKLKEKYPEDFVILGFPCNQF
GGQEPGTDDDIQEFCQLNYGVTFPIMQKTEVNGDNTNPLWAWLKDQQSGLLGLKRIKWNF
EKFLVGRDGKVKGRWASTTKPESLEEPILKALAEKTEA
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgtatgtatgtaactcggattggttcttgagatttattccctgccactctactaccaat
tctactgcaactgtacctgtacctgtacctggacctacctatctaatgtccctgtggcgt
gctactgctccccgttggttgactctacagccatcatcgagttccagttcccgctggctt
aataaatactacaccaccaccgctacgacctcttctcgttccccgcgattctcacctctc
aacacaaaacacaaccacagcagtcctcaccagagaaatatcactcataaccattttcgc
caactgagtacaactgcaaagatggcttccgctactagcttttacgacttcaagcctctt
gacaagcgcggtcaagaggttcccctcgccgactacaagggtaaggtcgtcctcattgtc
aacacagcctccaagtgcggcttcactccccagtatgctggtctcgagaagctctggacc
aagctcaaggagaagtaccctgaggactttgtcattctcggcttcccctgcaaccagttc
ggtggccaggagcccggcaccgacgacgacatccaggagttctgccagctcaactacggc
gtgaccttccccatcatgcagaagaccgaggtcaacggcgacaacaccaaccctctctgg
gcctggctcaaggaccagcagtcgggtcttttgggcctcaagcgcattaagtggaacttt
gagaagttccttgttggacgtgatggaaaggtcaaggggcgctgggctagcaccaccaag
cccgagtctctggaggagcctatcctgaaggctcttgcggagaagaccgaggcttaa

DBGET integrated database retrieval system