KEGG   Fusarium verticillioides: FVEG_05930Help
Entry
FVEG_05930        CDS       T04869                                 

Definition
(RefSeq) hypothetical protein
  KO
K01426  amidase [EC:3.5.1.4]
Organism
fvr  Fusarium verticillioides
Pathway
fvr00330  Arginine and proline metabolism
fvr00360  Phenylalanine metabolism
fvr00380  Tryptophan metabolism
fvr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fvr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    FVEG_05930
   00360 Phenylalanine metabolism
    FVEG_05930
   00380 Tryptophan metabolism
    FVEG_05930
Enzymes [BR:fvr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     FVEG_05930
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase Transp_inhibit
Motif
Other DBs
NCBI-GeneID: 30063874
NCBI-ProteinID: XP_018751168
UniProt: W7MJX9
Position
2
AA seq 557 aa AA seqDB search
MQVNNPVPVPKGTPEHEAKRAAVLKALADKVPAEFCLGPEFFKDTPLDVTKIPSTCGILT
DEEVAITEDYDATGLAEAIAKRKYTSMAVAKAFCKRAIIAHQLTCCLTQWFYDEAIQQAT
KLDEYLTEHGTTIGPLHGVPVSIKDHIPLAGTFASLGILATAEYDEHDSPLPAVLRKAGA
VFYCKTNQPQALMHGESDSPWGRALNPHNTTLTSGGSSGGEGALIAMKGSVLGIGTDIGG
SIRIPAAFSGIYGYKPTSGILSTRDLVHGPMIAELTVLANAGPMCRSARDMDLFMRLQLA
VKPHIRDLTLVPTNWTGLSTQLGLTLGRPLKVGIMTHDGFIQPQPPLKRALSWTSTLLSN
PRLSGLIEVKPFLPYGVKQAWDEIRQAYSPDGGIPSRDAILATGEPIYPLTEWIWRTAAP
KGMLTAGEMAYVRKACLDFRHAFAEDWERQDVDVILCPTGVGPATTHDTNFYLMYTALWN
YLDCPGLVFPTGLKVEGGEKYEADYQPLGPECAHVKELWESGNFTRAPINLQLVGRRYHD
NQLFGALKLFQGALGLE
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtcaacaaccctgtaccagtgccaaagggcacaccagagcacgaggccaaacgt
gctgctgttctcaaagcactcgccgacaaagtgcccgccgagttctgtctaggccctgaa
ttctttaaagacacccctctcgatgtcaccaagattccttctacctgtggtatactcaca
gacgaagaagtagccattacagaagactatgatgcaactggccttgctgaggctatcgcc
aaacgcaagtatacttctatggctgttgcgaaagccttttgcaagcgcgcgattatcgcc
catcagcttacctgctgtcttactcagtggttttatgatgaagctatccagcaagctacg
aaactggacgagtatctaacagagcatggaaccacgataggcccgctccatggtgtaccc
gttagcatcaaggaccatattccattggccggcacgttcgcatcgttgggtattctggct
acggctgagtacgacgagcatgactctccccttccagctgtccttcgcaaggccggcgca
gtcttttattgtaagacgaaccaaccccaggccctcatgcatggcgaaagtgactcgcct
tggggccgcgccttgaacccgcacaacaccactttgacatctggaggttccagtggtggt
gaaggagccttgattgctatgaagggctccgtcctcggcattggaaccgacattggaggc
agcattaggatccctgctgcgttcagtggtatctatggatataagccaacgagcggtatc
ctgtcaacaagggacttggtacatgggccaatgattgctgaactcactgtcttggctaac
gcaggtcccatgtgtcgatctgcacgcgacatggacctattcatgcgtcttcagcttgct
gtcaagccacatatcagagacctgactttggtccccacgaattggaccggcttgtcgaca
cagctgggcctgacccttgggaggccactcaaagttggtatcatgacacacgacggcttt
atccagcctcagccacccctcaagcgtgccctatcgtggactagtacccttctctcaaac
cctcgactatcaggacttattgaggtcaagccattcctaccatatggtgtgaaacaggcc
tgggacgaaatcagacaagcctactcccctgatggcggcataccgagtcgtgatgcgatc
ctcgcaacaggcgagccaatctatcctctcaccgaatggatctggagaaccgccgcgccc
aagggaatgctgactgccggtgaaatggcttacgtacgcaaagcatgcctcgacttccga
catgcttttgctgaggattgggagcgtcaggatgtcgatgtcatcctttgtcccactggt
gttggtccggctacgactcacgacacaaatttctatcttatgtacacagctctgtggaac
taccttgactgccccggtttggttttccctacggggctcaaggttgagggaggcgagaaa
tacgaagcggattatcagccgctgggacccgagtgcgctcatgtgaaggagctttgggag
agtgggaactttacaagagctcctatcaatcttcagcttgtggggaggagatatcatgac
aatcagctgtttggggctttgaagcttttccaaggcgctcttgggctggaatga

DBGET integrated database retrieval system