KEGG   Fusarium verticillioides: FVEG_07273Help
Entry
FVEG_07273        CDS       T04869                                 

Definition
(RefSeq) phospholipase A2
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
fvr  Fusarium verticillioides
Pathway
fvr00564  Glycerophospholipid metabolism
fvr00565  Ether lipid metabolism
fvr00590  Arachidonic acid metabolism
fvr00591  Linoleic acid metabolism
fvr00592  alpha-Linolenic acid metabolism
fvr01100  Metabolic pathways
fvr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fvr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    FVEG_07273
   00565 Ether lipid metabolism
    FVEG_07273
   00590 Arachidonic acid metabolism
    FVEG_07273
   00591 Linoleic acid metabolism
    FVEG_07273
   00592 alpha-Linolenic acid metabolism
    FVEG_07273
Enzymes [BR:fvr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     FVEG_07273
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B PTS_IIA DUF2229
Motif
Other DBs
NCBI-GeneID: 30065094
NCBI-ProteinID: XP_018753217
UniProt: W7M7P6
Position
8
AA seq 821 aa AA seqDB search
MRNYRGSLKSLNRVTTRLNTHPRIPRRRLSHRQHRHLWTSPSKNDAKQEAQQKSTFPVAV
ITGGLFIWWLYPSDDFAQLSGKQLRQRTHEDSPKDEKQDKTQDGESDSDQSAWINFARRF
ETFCKLNDVQFSSFSDKVVSYLLPEWSRLIPGYVRKLQRELSMSPGSLADEIWQDAHDPL
INPEIRYSAKVRVSPNLCDEEKEFLSRRKRVARVGLAKYLGLKEEDVHPDDVPTIAMCGS
GGGLRALIAGTGSILATEEDGLFDCVTYTSGVSGSCWLQALSLTSFNKGNIRNLLEHLKA
RASTHIAYPPVAFQSLASMPTNKYLLSGMVEKLKGDPKADFGLVDVYGVLLAARYLVPKG
DLGVNDRDFKLSNQRQYVQYGQLPMPIYTAVRHEIPDLPEAAEQGPIEAEIAKEKAKKEA
WFQWYEITPYEFFCEEFGAGIPTWALGRRFNQGCDVPPEDGFHLPELRLPLLMGIFGSAF
CATLSHYYREIKPLVQGLTGFGTIDELISTRDDDLVKVHPIDPAKIPNFAYGMHGKLPET
TPTSIYDNEYIQLMDAGMSNNLPIYPLLRPGRDVDVLVAFDASADIKTDNWLSVADGYAR
QRGVRGWPVGIGWPKPGEATSQVVEELDEAQAKSTREAEAKLREAKKEQDELRQEAHEEG
KQVMAESDKTKFEPGDQESGDLGYCTVWVGTNTERSTEPPPPSKAISTETSWQLMEPDAG
IAVVYLPFISNDKVPGISPGTTEYLSTWNFIYTPEQIDNVTALARANYDEGKQQIRDTIR
AVYQRKKKLREEAEKAQRQDRYRSRMRRGEGIRLGEGDHFS
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atgagaaactaccgcggctctctcaagagcctcaatagagtcactacaagactcaatacc
cacccgcggatcccccgacgaagattatcgcatcgtcaacaccgccatctgtggacatct
ccatccaaaaacgatgccaagcaagaagcacagcaaaaatcgacgtttccagtagcagta
attaccggcgggcttttcatctggtggctctacccttctgacgactttgcacagctttcc
ggtaaacaattgaggcagcgaacccatgaggactctccaaaggacgagaaacaagacaag
actcaggacggagaatcagatagtgaccagtcggcctggataaactttgctcgccgcttc
gagacgttctgtaagctcaacgatgttcaattctcctccttctccgacaaggtcgttagt
tatctcctccctgagtggtccagacttatcccaggctatgttcggaaactccagcgtgaa
ctctccatgtccccagggtctctggccgacgagatttggcaagacgcccacgacccccta
attaatcccgagattcgatattcagccaaagttcgagtttcacccaatctttgcgatgag
gagaaggaatttttgtcccggcgaaaacgagtcgccagagtagggctggctaaatatctg
ggactgaaggaggaggatgtccatccggatgatgttcccacaattgcaatgtgcggctct
ggtggaggtctgagagcacttattgctggaactggatcaattcttgccacagaagaagat
gggctgtttgactgcgtcacatacacctcgggcgtgagcggctcatgctggcttcaagct
ttgagtctcacatcgttcaacaagggaaacattcgtaaccttctcgagcacctcaaagct
agggcctcaacccatatcgcctacccgcccgtggccttccaatctcttgcttctatgccg
actaataaatacctgctgagtggcatggtcgagaagctcaagggtgatcccaaggcagat
tttggtctcgtcgatgtgtatggtgtcttactggcagctcggtaccttgtgccaaaaggg
gacctcggagtcaacgatcgcgactttaagctctcaaaccaacgccaatacgtccagtac
gggcaattaccgatgcccatctatactgctgtgagacacgagattcctgacttgccagag
gctgctgaacaaggcccaatcgaagccgagatcgccaaagagaaagccaagaaggaggcg
tggtttcagtggtatgagatcaccccgtacgaattcttttgtgaagagttcggcgccgga
atccccacctgggctttaggccgcagattcaaccagggatgtgatgttcctcctgaggat
ggcttccatctccccgaacttcgtttgccactcctcatgggcatctttggtagcgcattt
tgtgcaactctcagtcattattaccgagagatcaagccacttgtccagggtctgactggt
tttgggactattgatgaactcatctcgacacgagacgatgatttggtaaaagtgcatcct
attgatcctgccaaaatacccaactttgcctacggaatgcacggaaaattaccggaaacc
acgccgaccagtatttatgacaacgagtatattcagcttatggatgctggaatgtctaat
aacttgcctatctacccactcctgcgtccgggcagagatgtggacgtacttgttgccttt
gatgcctctgcagacatcaaaaccgacaactggctctcagtcgccgatggctacgcccgt
caacgcggtgttcggggttggcccgtcggcattggctggcccaagcccggagaagcaaca
tcccaggtagtagaagagctagacgaggcacaggcgaaatccactcgtgaagctgaggct
aagctccgcgaagccaagaaagagcaggatgagcttcgccaggaagctcacgaagagggc
aagcaagttatggcagagagtgacaagaccaaattcgagcctggggatcaagagtccggc
gatctgggctactgcactgtctgggttgggactaacacagaacgcagtactgagccacca
cctccctcaaaagcaatatcgaccgagacatcatggcagctcatggagcccgatgctggt
attgctgttgtctatttgcctttcatttccaacgacaaggtccctggtatttctccagga
actaccgagtaccttagcacatggaacttcatctatacccctgaacagattgataatgtc
actgcattggctcgagcaaactacgacgagggaaagcagcagattcgagataccatccgc
gcagtgtatcagcgcaagaagaagcttcgcgaggaagcagaaaaggcccaacgtcaggac
cgttatcgatcccgtatgaggagaggcgaaggcatccgtctaggcgaaggtgatcatttc
agttaa

DBGET integrated database retrieval system