KEGG   Fusarium verticillioides: FVEG_07484Help
Entry
FVEG_07484        CDS       T04869                                 

Definition
(RefSeq) succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
fvr  Fusarium verticillioides
Pathway
fvr00020  Citrate cycle (TCA cycle)
fvr00640  Propanoate metabolism
fvr01100  Metabolic pathways
fvr01110  Biosynthesis of secondary metabolites
fvr01130  Biosynthesis of antibiotics
fvr01200  Carbon metabolism
Module
fvr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fvr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fvr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FVEG_07484
   00640 Propanoate metabolism
    FVEG_07484
Enzymes [BR:fvr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     FVEG_07484
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     FVEG_07484
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 30065276
NCBI-ProteinID: XP_018753546
UniProt: W7MIE3
Position
8
AA seq 329 aa AA seqDB search
MQSFARATRASALQNVGRRAYSSSQYAQTINNLRINADTKVIYQGFTGKQGTFHAQQAIE
YGTKVVGGTNPKKAGQTHLGLPVFKNVGEAVKETGATATGLFVPPPLAAAGIEEALEAEI
PLVVCITEGIPQHDMVRITDMLKTQSKTRLVGPNCPGIIAPEQCKIGIMPGFIHKRGRIG
IVSRSGTLTYEAVNQTTQAGLGQSLVVGIGGDPFSGTNFIDCLKVFTEDPDTDGIIMIGE
IGGSAEEDAAEFLKQANTVNGGKPVVSFIAGISAPPGRRMGHAGAIVSGGKGGADTKIKA
LEDAGVIVERSPAGLGKALYNEFVRRDLL
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgcagtccttcgccagagccactcgcgcctcggcgctgcaaaacgttggccgccgagcc
tattcttcgtcgcagtatgcccagaccatcaacaacctgcgcatcaacgccgacaccaag
gtcatctaccagggcttcaccggaaagcagggaactttccacgctcaacaagctatcgaa
tacggcacaaaggtcgtcggtggaacaaaccccaagaaggctggccagactcacctcggc
ctccctgtcttcaagaacgttggtgaagccgtcaaggagactggtgccactgctactggt
ctcttcgtccctcctcctctggccgccgccggtatcgaggaggccctcgaggccgagatc
cccctcgttgtctgcatcactgagggtatcccccagcacgacatggttcgcatcaccgac
atgctcaagacccaaagcaagactcgtctcgtcggacccaactgccccggtatcattgct
cccgagcagtgcaagatcggtatcatgcctggcttcatccacaagcgcggccgcatcggt
atcgtctctcgttccggtactctgacctacgaggccgtcaaccagaccacccaggccggt
cttggtcagtctctcgttgtcggaatcggcggtgaccccttctccggtaccaacttcatc
gactgcctcaaggtcttcactgaggaccccgacaccgacggtatcatcatgattggtgag
attggtggttccgccgaggaggacgccgccgagttcctcaagcaggccaacactgtcaac
ggtggtaagccggttgtcagcttcatcgctggtatctctgctcctcccggccgacgaatg
ggtcacgccggtgccatcgtttccggtggtaagggtggtgccgacaccaagatcaaggct
cttgaggacgctggtgtcattgtcgagcgctctcccgctggtctgggcaaggctctctac
aacgagttcgtccgccgcgatctgctataa

DBGET integrated database retrieval system