KEGG   Fusarium verticillioides: FVEG_09077Help
Entry
FVEG_09077        CDS       T04869                                 

Definition
(RefSeq) thiamine biosynthetic enzyme
  KO
K03146  cysteine-dependent adenosine diphosphate thiazole synthase [EC:2.4.2.60]
Organism
fvr  Fusarium verticillioides
Pathway
fvr00730  Thiamine metabolism
fvr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fvr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    FVEG_09077
Enzymes [BR:fvr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.60  cysteine-dependent adenosine diphosphate thiazole synthase
     FVEG_09077
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thi4 DAO NAD_binding_8 Lycopene_cycl Pyr_redox_2 NAD_binding_9 FAD_binding_2 FAD_oxidored Pyr_redox_3 HI0933_like
Motif
Other DBs
NCBI-GeneID: 30066762
NCBI-ProteinID: XP_018755777
UniProt: W7MF57
Position
5
AA seq 427 aa AA seqDB search
MEGDIAHVMMCNPGSHLQLTRDPPHTHLSKHASTVGNTRHCILLVQHRPLCSVMISTGYF
YPSPAGIKRSRPFVPFPTLLLSLFINSSTRPKTLEEYPRYHNLPKIEMAPPAAVSPPSRS
AELATSTKLPVMSKNINTKTVEEMLGQWDDFKFAPIRESQVSRAMTRRYFQDLDNYAESD
IVIIGAGSCGLSAAYILGKKRPDLKIAIIEASVSPGGGAWLGGQLFSAMIMRKPADAFLR
EVGVPYEDEGNYVVVKHAALFTSTIMSKVLQMPNIKLFNATCVEDLITRPSEEGIRIAGV
VTNWTLVSMHHDDQSCMDPNTINAPLIISTTGHDGPMGAFCVKRLVSMQRIEKLGGMRGL
DMNLAEDAIVKGTREIVPGLIVGGMELSEVDGANRMGPTFGAMALSGLKAAEEALKIFDT
RKKQNDL
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggagggggatattgctcatgtcatgatgtgcaaccccggcagtcatcttcaactaaca
agagaccccccacacactcacctatcaaaacacgcgtctacagtaggtaatactcggcat
tgcattctgttggtccagcatcggccgctttgctccgtcatgatatcaacgggttacttt
tacccctcacctgcgggcataaaaaggtcaaggccgttcgttccattcccaactcttctt
ctttccctcttcatcaattcatcgactcgacccaagacactcgaagaatatccaagatat
cataacctgcccaagatagaaatggcccctcccgctgctgtctcccctccctctcgttct
gcagagcttgctacatctaccaagctcccagtcatgagcaagaacatcaacaccaagact
gttgaggagatgctcggtcagtgggatgacttcaagtttgctcccatccgtgagagccag
gtctcccgcgccatgacccgtcgctacttccaggaccttgataactatgccgagtctgac
attgttatcatcggtgctggttcgtgcggtctgagcgctgcgtacatccttggcaagaag
cgtcccgatctcaagatcgccatcatcgaggcttctgtttctcctggtggtggtgcttgg
cttggtggacagctcttctccgccatgatcatgcgcaagcctgctgatgctttcctccgc
gaggtcggtgttccttatgaagatgagggtaactacgttgttgtcaagcacgctgccctc
ttcacctctaccatcatgtccaaggttcttcagatgcccaacatcaagctcttcaatgcc
acttgtgttgaggatctcatcacccgaccttccgaggaaggcatccgcattgctggtgtt
gtcaccaactggactcttgtttccatgcatcacgatgaccagtcttgcatggaccccaac
actatcaacgctcctttgattatctccaccaccggccacgacggccccatgggagctttc
tgtgtcaagcgccttgtcagcatgcagcgcattgagaagcttggtggtatgcgtggtctt
gacatgaacctcgctgaggatgccattgtcaagggaacccgcgagattgttcctggtctt
attgttggtggaatggagctttctgaggttgacggtgccaaccgcatgggccctaccttc
ggtgccatggctctcagtggtctgaaggctgccgaggaagctctcaagatcttcgacact
cgcaagaagcagaacgatctgtaa

DBGET integrated database retrieval system