KEGG   Fusarium verticillioides: FVEG_09413
Entry
FVEG_09413        CDS       T04869                                 

Definition
(RefSeq) delta14-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
fvr  Fusarium verticillioides
Pathway
fvr00100  Steroid biosynthesis
fvr01100  Metabolic pathways
fvr01110  Biosynthesis of secondary metabolites
Module
fvr_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:fvr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    FVEG_09413
Enzymes [BR:fvr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     FVEG_09413
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 30067070
NCBI-ProteinID: XP_018756274
UniProt: W7MEU3
Position
5
AA seq 259 aa
MRTALTGWILFNCAFIAQQYRNYGYVSDSILVIATVQAYYVLEGQYSELGLLGMMDITQD
GLGFMLTWGNMVWVPFLYSTQCRYLSVYPVHLGPIGVSAIATVFAIGLYIFRSSNNQKAL
FRKDPNHPAFANMTFIQTKRGTKLLTGGWWGMARHINYFGDWLQSLPFSLPTKFAGYVIL
PAGSAVAGNEVVKMLDGRLVTPDGAAPWGMLFTYFYSAWFGFLLIHRERRDDAACIEKYG
KDWDEYKSKVKYRILPGVY
NT seq 780 nt   +upstreamnt  +downstreamnt
atgcgcactgctcttacaggctggatattgttcaactgcgctttcatcgctcagcagtat
cgcaactacggctatgtttctgatagtatcttagtcatcgctacggtgcaggcttactat
gtgcttgagggtcagtactcagagcttggattgctgggtatgatggatattacacaagat
ggtcttggattcatgcttacctggggtaacatggtctgggtccctttcctctactcgact
cagtgccgctacctctccgtctaccccgttcatctgggacctatcggtgtttccgccatc
gccactgtcttcgccatcggactgtacatcttccgatcttccaacaaccagaaggctctc
ttccgcaaagatcccaatcaccctgctttcgcaaacatgaccttcatccagaccaagcgc
ggaaccaagcttttgaccggcggatggtggggaatggcgcgtcacatcaactactttggt
gactggcttcagtctcttcctttttcgcttcctaccaaattcgcggggtatgttattctg
ccagctggtagtgctgtggctggcaatgaggtcgtcaaaatgttggatggtcgcttggta
actcccgacggcgctgcgccttggggtatgctgtttacgtacttttactcagcttggttt
ggtttcctgcttattcatcgggagaggagagatgatgctgcttgcattgagaagtatggc
aaggattgggatgagtacaagagcaaggttaaatacagaatcttgcctggcgtgtattaa

DBGET integrated database retrieval system