KEGG   Fusarium verticillioides: FVEG_10248Help
Entry
FVEG_10248        CDS       T04869                                 

Definition
(RefSeq) transketolase
  KO
K17100  dihydroxyacetone synthase [EC:2.2.1.3]
Organism
fvr  Fusarium verticillioides
Pathway
fvr00680  Methane metabolism
fvr01100  Metabolic pathways
fvr01200  Carbon metabolism
Module
fvr_M00344  Formaldehyde assimilation, xylulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:fvr00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    FVEG_10248
Enzymes [BR:fvr01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.3  formaldehyde transketolase
     FVEG_10248
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transketolase_N Transket_pyr DXP_synthase_N Transketolase_C E1_dh TPP_enzyme_C PepSY_2
Motif
Other DBs
NCBI-GeneID: 30067847
NCBI-ProteinID: XP_018757362
UniProt: W7MJF1
Position
9
AA seq 727 aa AA seqDB search
MAPSAIIPETQEEPVALSNVIKLIKNDDAETIDLALRQFRCLIADLCEQFKGGHPGGAMG
MAAIGLALWKYVMQYSPNEPNYFNRDRFVLSNGHTCLFQYTFLHLTGYKAMTFEHLKSYH
SSNYDSLAPGHPEIEHEGIEVTTGPLGQGIANAVGLAMATKNLAATYNKPNYDLINNMTY
CMIGDACLQEGVALEAIQLAGHWKLNNLVVMYDNNQITCDGSVDLCNTEDVNAKMRACGW
DVIEVQDGCFDVEGIVKALLKAKASTDKPTFINIHTVIGVGSKVAGDAKAHGAAFSPDGV
KAVKERFGMDPEKHYVVSDEVYNFFHDRKTRGDRLVENWKSLVDAYSKEYPDLHEEFMKR
VEGRFTDDWRSIIPTKESFPTAPTPSRKSAGIICNPLAAKLKNFMVGTADLSPSVNMIWK
DKVDFQHPDLKTTCGINGNYSGRYIHWGIREHAMASISNGLAAYGKGTILPVTSSFFMFY
IYAAPGVRMGALQNLQAIHIATHDSIGTGEDGPTHQPIALPALYRSMPNLLYIRPCDTEE
TAGAFITALEAKDTPSIISLSRQNLEQYPEHSSREGVQKGAYVFIEEEDADVTLIGVGAE
MVFAVKTREVLKEKFGIKARVVSFPCQRLFNSQPLEYKRQVLQYRSNAPRVVIEAYAVNG
WERYADAGYSMTTFGKSLPGKDAYKYFGFDENVIAPEVAKLVREVKAEGIESLRGEFRDL
NNVAHEH
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atggcaccaagcgcaatcatcccagagacgcaggaagagcctgtagctctttccaacgtt
atcaagttgatcaagaacgatgacgcagagacaattgatcttgccttgcgacagtttcgc
tgcttgatcgctgatctttgcgagcagttcaaaggcggccatcctggaggtgctatgggt
atggcggccattggcctcgccctctggaagtacgtgatgcagtactctcctaacgaacct
aactacttcaaccgcgatcgcttcgtcctctccaacggccacacatgtctcttccagtac
acattccttcatcttacaggctacaaggccatgaccttcgagcatctcaagtcctaccac
tcatccaactacgactcactggcgcccggtcatcctgagattgagcatgagggtatcgaa
gtaacgaccggtcccctcggacaaggcatcgccaacgctgtcggtctcgccatggcgact
aagaaccttgcggcaacttacaacaagcctaactacgatctcatcaacaacatgacttac
tgcatgatcggtgacgcttgtctgcaggagggtgtcgcccttgaggctattcagctggct
ggccattggaagctcaacaaccttgtcgtgatgtatgacaacaaccagattacttgcgat
ggtagtgtcgacctctgcaacaccgaggacgtcaacgccaagatgcgcgcctgtggttgg
gacgtgatcgaggtccaagacggctgtttcgatgtcgagggtattgtcaaggccctcctc
aaagccaaggccagtaccgacaaacccactttcatcaacattcacactgttatcggagtt
ggtagcaaggttgccggcgatgccaaagcccacggtgccgctttcagccccgatggtgtt
aaggctgtcaaggaacgtttcggcatggaccctgagaagcactacgtcgtctctgatgag
gtctacaacttcttccacgaccgcaagactcgtggtgaccgcctcgtcgagaattggaag
agtcttgttgatgcctacagcaaggagtaccctgatcttcatgaagagttcatgaagcgt
gtcgagggccgctttactgacgactggcggagcatcatccctaccaaggagtcattccct
accgctcctacaccttcccgaaagtctgccggtatcatctgcaaccccctggctgcgaaa
ctcaagaacttcatggtcggcacagctgacctgtcaccctctgtcaacatgatctggaag
gacaaggttgacttccagcatcccgacctcaagaccacctgcggcatcaatggcaactac
tccggccgctacatccattggggcattcgtgagcatgcgatggcttcaatctccaacggt
ctcgctgcttacggcaagggcacgattctccctgtcacctcaagtttcttcatgttctac
atttacgccgcccctggtgtccgcatgggcgctcttcagaacctccaagccatccacatt
gccactcacgactcgatcggtaccggtgaagacggtccaacccaccaaccgattgctctc
cctgctctgtaccgttccatgcccaacctcctttacatccgaccttgcgataccgaagag
acggccggtgccttcatcaccgccctcgaggccaaggacaccccatctatcatctcgctc
tcccgtcagaacctcgagcagtaccctgagcactccagtcgcgaaggtgttcagaagggt
gcttatgtcttcatcgaggaggaggatgccgacgttacactcatcggcgtcggtgcggaa
atggtcttcgccgtcaagacccgtgaggtcctcaaggagaagttcggcatcaaggcccgc
gtggtctcgttcccttgccagcgtctcttcaactcccaacccctcgagtacaaacgccaa
gtccttcaataccgctccaacgcccctcgagttgtgattgaggcctacgccgtcaacggc
tgggagcgatacgccgatgctggctactcaatgactacctttggcaagtcactgcctggt
aaggacgcctacaaatacttcggctttgatgagaacgtcattgcccctgaggtggccaag
cttgtccgcgaggtcaaggcggaagggatcgagagcctacgcggcgaattcagggatctc
aacaacgtggcacacgagcactaa

DBGET integrated database retrieval system