KEGG   Fusarium verticillioides: FVEG_11805Help
Entry
FVEG_11805        CDS       T04869                                 

Definition
(RefSeq) 2-haloacid dehalogenase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
fvr  Fusarium verticillioides
Pathway
fvr01100  Metabolic pathways
Brite
Enzymes [BR:fvr01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     FVEG_11805
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase Hydrolase_6
Motif
Other DBs
NCBI-GeneID: 30069294
NCBI-ProteinID: XP_018759548
UniProt: W7NA48
Position
7
AA seq 240 aa AA seqDB search
MANQKHVVFDVVGTCVSFDAFYKGIDRVIGEKLASKHITANAFGYTWMTAAELEFTFLSV
SERHRPYKEVLRTLFYRTLFMVGVAEPRKLVTDEERDACVLAYSDLELRPGAAECFQILR
DAGFTVWCLTTGDVKRVGGYFERAGVEMPLENLISCDGQGVAKPALAAYRPTLAQFAPDD
IKWFAAAHMWDVSAAVKVGFRGAYCTIYEQDPCAEIFDTKMEVIADTLPDMAKGIVKGSL
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggccaatcagaagcatgtcgtcttcgacgtcgtcggcacctgtgtctcatttgatgcc
ttctacaaaggcatcgatcgcgtcattggcgagaagctagcctccaagcacatcacagcc
aatgccttcggctacacttggatgacagcagccgagctggagttcaccttcctctccgtc
tctgagcgccaccgtccctacaaagaagttctgcgcaccttgttctaccgcacgctcttc
atggttggcgttgcggagccaagaaaactcgtcacggacgaagaaagggacgcctgtgtc
ctggcttattcggacctcgagttgcgacccggagccgcagagtgctttcaaatattgaga
gacgcaggcttcacagtgtggtgtttgacaacgggcgatgtcaagcgtgtgggtggatac
tttgagcgcgctggcgttgagatgccgctcgagaatctcatcagctgcgacggacagggc
gtggccaaaccagcgttggctgcgtacaggccaactctagctcaattcgcacccgatgat
atcaagtggttcgctgctgctcacatgtgggacgtatcagctgcagtcaaggttggcttc
cgaggtgcttactgcactatatacgaacaggatccttgcgctgagatctttgataccaag
atggaggttatagctgatacactaccagacatggcaaaggggattgtaaagggatcgctt
tag

DBGET integrated database retrieval system