KEGG   Fusarium verticillioides: FVEG_16233Help
Entry
FVEG_16233        CDS       T04869                                 

Definition
(RefSeq) hypothetical protein
  KO
K00846  ketohexokinase [EC:2.7.1.3]
Organism
fvr  Fusarium verticillioides
Pathway
fvr00051  Fructose and mannose metabolism
fvr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fvr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    FVEG_16233
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fvr04147]
    FVEG_16233
Enzymes [BR:fvr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.3  ketohexokinase
     FVEG_16233
Exosome [BR:fvr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FVEG_16233
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-GeneID: 30073109
NCBI-ProteinID: XP_018754294
UniProt: W7M919
Position
3
AA seq 317 aa AA seqDB search
MKHLIAVGACYLDTILTNVTSTAYAWHLLIYLQCSLLPIRRLQVLEQLLSERDTLQLHLI
SPLPAAASSATQRVISSFGAQSNIDFSHCVYREESMEAASSYIMRSEASGSRTLVNYNGL
LEMTEDEFGNIARGFNPDQETWWHFEGRIPDTILSCIRLLRNVLPKATISVEIEKPGREG
LPELAAEVDVVFYSRSWAESRGYRTPEQCLRAEGHQKASLALCTWGEDGAAGLSRSTGES
IHCPALDKSGRDISVLDAVGAGDTFIAGMLYGLICHPDDWSMGQKLGFAVRLATLKVQRE
GFDGLGRDMLGKEIGGV
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaagcatctcattgctgtaggggcttgttacctggatacgatcctcacgaacgtcacc
tctactgcgtacgcatggcatttactaatctacctccagtgttcccttcttcccatccga
agactccaagtcttagagcaattactctccgagcgcgacaccctccagctacatctaata
tcacccctccccgctgcagcgtcgtccgcaacacagcgtgttatatcgtcgttcggtgca
cagtcgaacattgacttcagccactgcgtttatcgtgaggagagcatggaggcggcaagc
agttacatcatgcgtagcgaggcatcgggtagtcgcacgcttgtcaattacaatggctta
ttagaaatgaccgaagacgagtttggcaacatcgcgcgaggcttcaacccggaccaggag
acatggtggcactttgagggccgaatcccggataccatactgagctgtatccgtctcctg
cgtaacgtactaccaaaagcgacaatcagtgtcgaaattgagaagcctggtagagaaggc
ctccctgagctggcggcagaagtggatgttgtcttctattcgcgaagttgggctgagagt
cgaggatacaggactccggaacaatgcttgagagctgaagggcatcaaaaggcgtcactg
gcactgtgtacgtggggtgaagatggagcagctgggctgtctcgatcgacaggcgagagt
attcactgccctgccctggataaatcagggcgagacatttccgtgctcgatgccgtggga
gcgggggacactttcatagccggaatgctgtacggactgatctgtcaccctgacgactgg
agcatggggcagaagctgggtttcgccgttcgactggctacgctcaaagtgcagcgggag
gggtttgacggactcggaagagacatgcttggaaaggagattggaggcgtctga

DBGET integrated database retrieval system