KEGG   Gossypium arboreum: 108450728Help
Entry
108450728         CDS       T05776                                 

Definition
(RefSeq) probable receptor-like protein kinase At1g80640
Organism
gab  Gossypium arboreum
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Kinase-like PIP49_C
Motif
Other DBs
NCBI-GeneID: 108450728
NCBI-ProteinID: XP_017603967
UniProt: A0A0B0NFU0
Position
10
AA seq 441 aa AA seqDB search
MNLLCLLFPMWACSFSLFSLLIHARPQSTVPFTSASVLPSEQEPISQFSSQMEAVSPGVA
VVRVVHHQDLNKRILIALIVASTLLAGILLFLLCFWICRQKILNNSNGKSKQKNLEPTKA
LSLSPIVDRFNSLWMAGKKGSVAVIEYRLLEAATNCFGESNVLGEGGRGRVYKARFDDKF
LAAVKKLDNGGVDAEREFENEVDWLVKIRHQNVVSLLGYCIHGETKLLVYEMMQNGSLES
QLHGPSQGSALTWHLRMKIAIDVARALEYLHENCNPPVVHRDIKSSNILLDSNFNAKLSD
FGLAVTTGSQNKNVKLSGTLGYVAPEYLLEGKLTDKSDVYAFGVVLLELLIGKKPLEKMS
PTQHQSLVTWVMPQLTDRLKLPKLVDPVIKDTMDLKHLYQVAAVAVLCIQPEPSYRPLIT
DVLHSLIPLVPIELGGSLRLT
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttctgtgtctactatttcccatgtgggcatgttccttctctttgttttcactc
ttaattcatgcccgaccacagtcaactgttcccttcacatccgcttctgttcttccttct
gaacaagaacccatttctcagttttcttcacagatggaagctgtttctccaggggtggct
gttgttcgagtagtgcaccaccaggatctaaacaagagaattcttatagctctaattgtt
gcctccactcttcttgctggaatattgctctttttgttatgtttctggatatgtagacag
aaaatcttgaacaactccaatgggaaaagcaaacaaaaaaacctagaacctacaaaagca
ctttcattgagtccaattgtggatcgttttaattccttatggatggctgggaaaaagggg
tcagtagctgtcatcgagtatcggttattggaagctgcaacaaactgtttcggggaaagt
aatgttttgggtgagggcggtcgtggacgtgtctataaagctcgcttcgatgacaaattt
cttgctgctgtgaaaaaattagataatggaggagtggatgctgaaagggagttcgagaat
gaggtggactggctggtcaaaattcggcatcagaatgttgtatcgcttttaggttactgt
atccatggtgaaacaaagttacttgtatatgaaatgatgcaaaatggttctttggagagt
cagttacacggaccttctcaaggatcagctttaacctggcatttacgaatgaaaattgca
attgatgttgctagagcgttagagtatcttcacgagaactgcaatccaccagtcgtccat
agagatataaagtcatctaatatccttctcgattccaacttcaatgctaagctatcggac
tttggccttgctgtgactactggatctcagaacaaaaacgttaagttgtccggaacattg
ggctatgtagctccagagtacctcttagagggtaaattgaccgataaaagtgatgtatat
gctttcggagttgtacttttggagctgctaatcggaaagaaaccgctagagaaaatgtca
ccaactcagcaccaatctcttgttacatgggtcatgccccagcttaccgacagattgaaa
cttccgaagttagttgatccagtaataaaagacacaatggatttaaagcacttatatcag
gtcgctgctgttgcggtgctgtgcatacagcccgaaccaagttataggccactcataact
gatgtcctgcattctctcatccctcttgtaccgatagaacttggaggttcgttaagactt
acatag

DBGET integrated database retrieval system