KEGG   Gossypium arboreum: 108450789Help
Entry
108450789         CDS       T05776                                 

Definition
(RefSeq) cysteine-rich receptor-like protein kinase 10
Organism
gab  Gossypium arboreum
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase
Motif
Other DBs
NCBI-GeneID: 108450789
NCBI-ProteinID: XP_017604046
Position
10
AA seq 392 aa AA seqDB search
MGFLAKLSACIAKRFKAARGGSAGEDDSDDGSDTQGLFFELRALQIATNYFSELNRLGHG
GFGPVYKGLMPNGQEIAVKKLAMDSRQGLKQFINEVKLLLKTQHKNLVMLFGCCAEGPEK
MLVYEYLPNKSLDYFLFDKSKSPSLDWTTRFKIITGIARGLLYLHEEAPQRIIHIDIKAS
NILLDQQLNPKISDFGLARLFPGDDTHVNTFRISGTHGYMAPEYAMHGYLSVKTDVFSYG
VVVLEIVSGRKNHDSRLGSEKADLLNYSWLLFQGGKMLDLVDPTLEKYNPDEAAMCIQLG
LLCCQQTVVERPDMNSVHLMLSSDSFTLPRPGKPAIQGRVGRWTTTSTSAFTNTNTNASS
TNGGMTKVSAGSSFVEDYSRNSISYSSIEEGR
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgggattcttggctaaactttctgcttgcatcgccaaacgcttcaaagccgctcgaggt
ggatccgccggagaagacgattccgacgacggatccgacactcagggccttttcttcgaa
ctccgtgctctccagattgctactaactatttctctgaacttaatcgcctcggtcatggt
ggctttggtcctgtctacaagggtttgatgccaaatggtcaagagatagctgtgaagaag
cttgcaatggattcaagacagggactgaaacaattcattaatgaggtgaagcttttattg
aaaacccagcacaagaacttagtgatgttgttcgggtgctgcgcagaaggacctgagaag
atgcttgtttatgagtatttgccaaataaaagtcttgattactttctctttgacaagagc
aagtctccttccttggattggactacaagatttaagataatcacaggcattgcaagaggt
ctcctctacctgcatgaagaggcgcctcaaaggatcattcatatagacatcaaagccagt
aacatattgttggatcaacaattgaacccaaaaatctctgattttggcttggcaaggctc
tttcctggggatgatactcatgtaaatacttttaggatttctggcacccatggttacatg
gcccctgaatatgccatgcatgggtatttgtctgtgaagacagatgttttcagctatgga
gttgtggtcttggagatagtaagtggcagaaaaaaccatgatagccgtcttggttcagag
aaggcagacctcttgaactattcatggctgctatttcaaggcggaaagatgttggattta
gttgatccaaccctcgagaaatacaatcctgacgaggcagcaatgtgcattcagctaggc
ttgttatgctgtcaacagactgttgtcgagagaccagacatgaactccgttcatctcatg
ctttccagcgattcattcaccttgccgagaccaggtaaaccagcaatccaagggcgtgta
ggccggtggacgaccacatctacttcagcttttactaatacaaacactaatgcaagtagc
accaatgggggtatgacaaaggtttcggcgggaagtagctttgttgaagattattctagg
aattccatatcctattcgtccattgaagaaggtagatga

DBGET integrated database retrieval system